Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.99
PubTator Score 9.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
astrocytic glioma 2597 5.0e-02
Disease Target Count Z-score Confidence
Leigh disease 100 3.421 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
astrocytic glioma -1.300 5.0e-02

Synonym

Accession O14548 Q9P118
Symbols EB1
SIG81
COX7AR
COX7RP

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKA      1 - 70
DGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK                               71 - 114
//

Text Mined References (16)

PMID Year Title