Property Summary

NCBI Gene PubMed Count 32
Grant Count 12
R01 Count 3
Funding $1,430,332.42
PubMed Score 73.83
PubTator Score 244.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26183850 miR-142-3p regulates NPC development by down-regulating SOCS6 expression and suggest that modulation of miR-142-3p expression could be a therapeutic strategy for NPC
25025962 Stage-independent downregulation of SOCS2 and SOCS6 correlate with disease-free survival in colorectal cancer.
24801601 miR-17-5p might function as a pro-proliferative factor by repressing SOCS6 in gastric cancer
23653113 Studied both the function of upregulated miR-424-5p in pancreatic cancer and how downstream suppressor of cytokine-induced signaling 6 (SOCS6) is negatively regulated by miR-424-5p.
23475171 SOCS2 and SOCS6 expression are remarkably reduced in hepatocellular carcinoma and correlate with aggressive tumor progression and poor prognosis
22955947 Results show that SOCS6 forms complex with DRP1 and the mitochondrial phosphatase PGAM5, attenuates DRP1 phosphorylation, and promotes DRP1 mitochondrial translocation.
22952242 SOCS6 negatively regulates Flt3 activation, the downstream Erk signaling pathway, and cell proliferation.
22363434 Reduced copy number and mRNA expression of SOCS6 are associated with disease recurrence in primary lung squamous cell carcinoma and may be useful prognostic biomarkers.
22081311 The results may contribute to understanding SOCS5 and SOCS6 expression regulation in various cancer tissues, and show that these two factors may be used for diagnosing cancer.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKS      1 - 70
ESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLR     71 - 140
PTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVP    141 - 210
VVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIF    211 - 280
VDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNS    281 - 350
APGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL    351 - 420
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNP    421 - 490
VSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY                             491 - 535
//

Text Mined References (34)

PMID Year Title
26183850 2015 MiR-142-3p Suppresses SOCS6 Expression and Promotes Cell Proliferation in Nasopharyngeal Carcinoma.
25180228 2014 Opposing activities of the Ras and Hippo pathways converge on regulation of YAP protein turnover.
25025962 2014 Identification of SOCS2 and SOCS6 as biomarkers in human colorectal cancer.
24801601 2014 miR-17-5p promotes proliferation by targeting SOCS6 in gastric cancer cells.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
23653113 2013 MicroRNA-424-5p suppresses the expression of SOCS6 in pancreatic cancer.
23475171 2013 Reduced expression of SOCS2 and SOCS6 in hepatocellular carcinoma correlates with aggressive tumor progression and poor prognosis.
22955947 2013 Suppressor of cytokine signaling 6 (SOCS6) promotes mitochondrial fission via regulating DRP1 translocation.
22952242 2012 Suppressor of cytokine signaling 6 (SOCS6) negatively regulates Flt3 signal transduction through direct binding to phosphorylated tyrosines 591 and 919 of Flt3.
22363434 2012 Array-comparative genomic hybridization reveals loss of SOCS6 is associated with poor prognosis in primary lung squamous cell carcinoma.
More...