Property Summary

NCBI Gene PubMed Count 35
PubMed Score 79.51
PubTator Score 244.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 2.100 9.8e-06
Astrocytoma, Pilocytic 2.000 6.3e-08
atypical teratoid / rhabdoid tumor 2.500 7.0e-06
ependymoma 1.600 2.0e-08
glioblastoma 1.900 4.4e-11
group 4 medulloblastoma 1.500 2.1e-04
invasive ductal carcinoma 1.300 2.9e-02
medulloblastoma, large-cell 1.700 4.4e-03
ovarian cancer -1.600 3.5e-06
primitive neuroectodermal tumor 1.500 3.3e-04

Synonym

Accession O14544 Q8WUM3 SOCS-6
Symbols CIS4
SSI4
CIS-4
SOCS4
STAI4
SOCS-4
SOCS-6
STATI4
HSPC060

Gene

PANTHER Protein Class (2)

PDB

2VIF  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (7)

Gene RIF (23)

AA Sequence

MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKS      1 - 70
ESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLR     71 - 140
PTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVP    141 - 210
VVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIF    211 - 280
VDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNS    281 - 350
APGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL    351 - 420
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNP    421 - 490
VSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY                             491 - 535
//

Text Mined References (37)

PMID Year Title