Property Summary

NCBI Gene PubMed Count 385
PubMed Score 1157.16
PubTator Score 660.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 7.1e-28
periodontitis 293 2.8e-16
non-small cell lung cancer 2890 2.4e-14
chronic lymphosyte leukemia 204 1.4e-13
lung carcinoma 2843 6.2e-08
lung cancer 4740 2.5e-05
Astrocytoma, Pilocytic 3081 1.6e-04
cystic fibrosis 1696 2.9e-04
pituitary cancer 1972 3.1e-04
Atopic dermatitis 952 4.2e-04
juvenile dermatomyositis 1187 4.9e-04
ovarian cancer 8520 1.0e-03
Breast cancer 3578 1.4e-03
non diabetic and post-ischemic heart failure 200 1.7e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 2.0e-03
primary pancreatic ductal adenocarcinoma 1109 2.1e-03
gastric carcinoma 807 3.5e-03
invasive ductal carcinoma 2951 4.4e-03
urothelial carcinoma 318 5.1e-03
Duchenne muscular dystrophy 601 7.8e-03
osteosarcoma 7950 7.9e-03
interstitial cystitis 2312 8.9e-03
ependymoma 4679 9.1e-03
medulloblastoma, large-cell 6241 9.8e-03
atypical teratoid / rhabdoid tumor 5112 1.1e-02
adrenocortical carcinoma 1428 1.2e-02
acute quadriplegic myopathy 1158 1.4e-02
glioblastoma 5792 1.6e-02
limb girdle muscular dystrophy 2B 40 1.7e-02
tuberculosis 2010 1.8e-02
pediatric high grade glioma 1064 1.8e-02
intraductal papillary-mucinous carcinoma (IPMC) 2989 2.1e-02
non primary Sjogren syndrome sicca 891 2.2e-02
active ulcerative colitis 764 2.6e-02
Bipolar Disorder 666 2.8e-02
head and neck cancer 271 2.8e-02
pancreatic carcinoma 562 2.9e-02
pancreatic cancer 2398 2.9e-02
type II diabetes mellitus and post-ischemic heart failure 88 3.2e-02
Rheumatoid arthritis 1191 3.2e-02
interstitial lung disease 298 3.5e-02
heterozygous familial hypercholesterolemia 2 4.0e-02
aldosterone-producing adenoma 665 4.5e-02

Expression

  Differential Expression (43)

Disease log2 FC p
active ulcerative colitis 2.014 2.6e-02
acute quadriplegic myopathy 1.692 1.4e-02
adrenocortical carcinoma -1.827 1.2e-02
aldosterone-producing adenoma -1.325 4.5e-02
Astrocytoma, Pilocytic 1.100 1.6e-04
Atopic dermatitis 1.800 4.2e-04
atypical teratoid / rhabdoid tumor 1.600 1.1e-02
Bipolar Disorder 1.002 2.8e-02
Breast cancer 1.200 1.4e-03
chronic lymphosyte leukemia -1.400 1.4e-13
cystic fibrosis 2.600 2.9e-04
Duchenne muscular dystrophy 1.120 7.8e-03
ependymoma 1.600 9.1e-03
gastric carcinoma 3.300 3.5e-03
glioblastoma 1.400 1.6e-02
head and neck cancer 2.100 2.8e-02
heterozygous familial hypercholesterolem... 1.008 4.0e-02
interstitial cystitis 2.600 8.9e-03
interstitial lung disease -1.300 3.5e-02
intraductal papillary-mucinous adenoma (... -2.600 2.0e-03
intraductal papillary-mucinous carcinoma... -2.100 2.1e-02
invasive ductal carcinoma -1.354 4.4e-03
juvenile dermatomyositis 1.033 4.9e-04
limb girdle muscular dystrophy 2B 1.115 1.7e-02
lung cancer -2.000 2.5e-05
lung carcinoma -2.100 6.2e-08
medulloblastoma, large-cell -1.300 9.8e-03
non diabetic and post-ischemic heart fai... -1.500 1.7e-03
non primary Sjogren syndrome sicca -1.200 2.2e-02
non-small cell lung cancer -1.521 2.4e-14
osteosarcoma 1.460 7.9e-03
ovarian cancer 2.300 1.0e-03
pancreatic cancer 1.300 2.9e-02
pancreatic carcinoma 1.300 2.9e-02
pediatric high grade glioma 1.500 1.8e-02
periodontitis 1.200 2.8e-16
pituitary cancer -1.500 3.1e-04
primary pancreatic ductal adenocarcinoma 2.481 2.1e-03
psoriasis 1.600 7.1e-28
Rheumatoid arthritis 2.000 3.2e-02
tuberculosis -1.200 1.8e-02
type II diabetes mellitus and post-ische... -1.400 3.2e-02
urothelial carcinoma -2.600 5.1e-03

 GO Component (2)

Protein-protein Interaction (5)

Gene RIF (354)

AA Sequence

MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLI      1 - 70
RDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPP     71 - 140
TEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQL    141 - 210
PGPIREFLDQYDAPL                                                           211 - 225
//

Text Mined References (387)

PMID Year Title