Property Summary

NCBI Gene PubMed Count 348
Grant Count 361
R01 Count 220
Funding $24,181,112.85
PubMed Score 1085.68
PubTator Score 660.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (58)

Disease Z-score Confidence
Obesity 616 4.901 2.5
Stuttering 18 4.588 2.3
Cancer 2,346 4.175 2.1
diabetes mellitus 1,663 3.82 1.9
Hepatitis C 90 3.406 1.7
Metabolic syndrome X 155 3.128 1.6
Arthritis 248 3.125 1.6
Inflammatory bowel disease 142 3.053 1.5
Vascular disease 281 3.003 1.5
Atherosclerosis 275
Atopic dermatitis 944
Bipolar Disorder 266
Breast cancer 3,094
DERMATITIS, ATOPIC, 4 1
Duchenne muscular dystrophy 602
Endometrial Neoplasms 50
Liver carcinoma 217
Liver diseases 66
Myocardial Ischemia 169
Rheumatoid Arthritis 1,160
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
atypical teratoid / rhabdoid tumor 4,369
chronic lymphosyte leukemia 232
cystic fibrosis 1,665
gastric carcinoma 832
glioblastoma 5,572
head and neck cancer 270
heterozygous familial hypercholesterolem... 1 
interstitial cystitis 2,299
interstitial lung disease 291
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2B 74
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
non diabetic and post-ischemic heart fai... 200 
non primary Sjogren syndrome sicca 840
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pediatric high grade glioma 2,712
periodontitis 269
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
tuberculosis and treatment for 3 months 327
type II diabetes mellitus and post-ische... 89 
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

  Differential Expression (43)

Disease log2 FC p
Rheumatoid Arthritis 3.700 0.001
pancreatic cancer 2.600 0.003
interstitial lung disease -2.200 0.020
urothelial carcinoma -2.600 0.005
glioblastoma 1.700 0.020
osteosarcoma 1.460 0.008
chronic lymphosyte leukemia -1.400 0.000
posterior fossa group A ependymoma 2.400 0.000
non diabetic and post-ischemic heart fai... -1.500 0.002
type II diabetes mellitus and post-ische... -1.400 0.032
periodontitis 1.200 0.000
atypical teratoid / rhabdoid tumor 1.600 0.011
medulloblastoma, large-cell -1.300 0.010
Duchenne muscular dystrophy 1.120 0.008
juvenile dermatomyositis 1.033 0.000
limb girdle muscular dystrophy 2B 1.115 0.017
acute quadriplegic myopathy 1.692 0.014
Atopic dermatitis 1.800 0.000
adrenocortical carcinoma -1.827 0.012
primary pancreatic ductal adenocarcinoma 2.481 0.002
tuberculosis and treatment for 3 months -1.600 0.002
non-small cell lung cancer -1.788 0.000
intraductal papillary-mucinous adenoma (... -2.600 0.002
intraductal papillary-mucinous carcinoma... -2.100 0.021
lung cancer -2.800 0.000
ulcerative colitis 4.800 0.000
interstitial cystitis 4.000 0.000
cystic fibrosis 2.600 0.000
pediatric high grade glioma 1.500 0.018
pilocytic astrocytoma 2.500 0.000
non primary Sjogren syndrome sicca -1.200 0.022
pancreatic carcinoma 1.500 0.023
aldosterone-producing adenoma -2.595 0.038
psoriasis -3.000 0.000
invasive ductal carcinoma -1.371 0.002
lung carcinoma -2.100 0.000
heterozygous familial hypercholesterolem... 1.008 0.040
gastric carcinoma 3.800 0.003
Bipolar Disorder 1.002 0.028
ovarian cancer 2.300 0.001
Breast cancer 1.200 0.001
pituitary cancer -4.000 0.000
head and neck cancer 2.100 0.028

Synonym

Accession O14543 O14509 SOCS-3
Symbols CIS3
SSI3
ATOD4
Cish3
SSI-3
SOCS-3

Gene

 GO Component (2)

Gene RIF (316)

PMID Text
26990535 miR-203 and miR-221 regulate SOCS1 and SOCS3 in essential thrombocythemia
26812031 Increased SOCS3 expression in PBMCs and T cells from patients with ankylosing spondylitis correlates with patient's functional ability, acute-phase reactants and serum pro-inflammatory cytokines.
26707189 Treatment of isolinderalactone increased the protein level of SCOS3, decreased phosphorylation of the STAT3 and suppressed expression of the down-stream genes of the X-linked inhibitor of apoptosis protein
26668321 Data suggest that PCSK9 is involved in regulation of lipid metabolism in hepatocytes by proinflammatory cytokine TNFalpha; induction of lipogenesis and insulin resistance in liver (as seen in obesity) involves up-regulation of both PCSK9 and SOCS3.
26485275 Decreased SOCS3 expression is associated with cholangiocarcinoma.
26464723 A significant relevance involved in SOCS3 gene polymorphisms and infantile asthma development based on a Chinese Han population.
26447993 Our findings suggest that the rs4969170A>G polymorphism of SOCS3 gene may be used as a prognostic predictor for HCC patients who underwent surgical treatment.
26429311 Dysregulation of SOCS3 functions can cause a variety of diseases, including allergy, autoimmune diseases, inflammation and cancer. (Review)
26416445 induction of SOCS3 may be a novel mechanism by which FXR exerts its anti-hepatocellular carcinoma effects
26393582 In hepatocellular carcinoma tumor tissues, SOCS3 showed an increased methylation frequency and intensity compared with that in the adjacent non-tumor tissues.
More...

AA Sequence

MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLI      1 - 70
RDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPP     71 - 140
TEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQL    141 - 210
PGPIREFLDQYDAPL                                                           211 - 225
//

Text Mined References (350)

PMID Year Title
26990535 2016 miR-203 and miR-221 regulate SOCS1 and SOCS3 in essential thrombocythemia.
26812031 Suppressors of cytokine signalling in ankylosing spondylitis and their associations with disease severity, acute-phase reactants and serum cytokines.
26707189 2016 Isolinderalactone enhances the inhibition of SOCS3 on STAT3 activity by decreasing miR-30c in breast cancer.
26668321 2016 Suppressor of Cytokine Signaling-3 (SOCS-3) Induces Proprotein Convertase Subtilisin Kexin Type 9 (PCSK9) Expression in Hepatic HepG2 Cell Line.
26485275 2015 The Prognostic Role of SOCS3 and A20 in Human Cholangiocarcinoma.
26464723 2015 Genetic correlation of SOCS3 polymorphisms with infantile asthma: an evidence based on a case-control study.
26447993 2015 SOCS3 Genetic Polymorphism Is Associated With Clinical Features and Prognosis of Hepatocellular Carcinoma Patients Receiving Hepatectomy.
26429311 2015 SOCS3 and its role in associated diseases.
26416445 2015 FXR induces SOCS3 and suppresses hepatocellular carcinoma.
26393582 2015 SOCS3 Methylation Predicts a Poor Prognosis in HBV Infection-Related Hepatocellular Carcinoma.
More...