Property Summary

NCBI Gene PubMed Count 348
PubMed Score 1085.68
PubTator Score 660.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
periodontitis 269 2.82945287531679E-16
non-small cell lung cancer 2798 6.22187876774344E-15
chronic lymphosyte leukemia 232 1.3728381506545E-13
lung carcinoma 2844 6.16144146777618E-8
ulcerative colitis 2087 6.65181279915997E-8
psoriasis 6685 2.19953775715305E-7
pituitary cancer 1972 3.45462170794266E-7
posterior fossa group A ependymoma 1511 8.09635159358897E-7
pilocytic astrocytoma 3086 3.70454933990329E-6
interstitial cystitis 2299 1.90954805845811E-5
lung cancer 4473 2.56195883645058E-5
cystic fibrosis 1670 2.87865119734638E-4
Atopic dermatitis 944 4.20574183623169E-4
juvenile dermatomyositis 1189 4.91304417380309E-4
ovarian cancer 8492 0.00104691225515175
Rheumatoid Arthritis 1171 0.001171869130372
Breast cancer 3099 0.0013772065135696
invasive ductal carcinoma 2950 0.0015782456055093
tuberculosis and treatment for 3 months 327 0.00168350730352519
non diabetic and post-ischemic heart failure 200 0.00170432740235413
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00196386161736778
primary pancreatic ductal adenocarcinoma 1271 0.002065597144128
gastric carcinoma 832 0.00303545841302843
pancreatic cancer 2300 0.0031555662295885
urothelial carcinoma 318 0.00514841995917342
Duchenne muscular dystrophy 602 0.00784691628400511
osteosarcoma 7933 0.00785375763840834
medulloblastoma, large-cell 6234 0.0097921556719889
atypical teratoid / rhabdoid tumor 4369 0.0109680238880346
adrenocortical carcinoma 1427 0.0118348240845038
acute quadriplegic myopathy 1157 0.0139185313969465
limb girdle muscular dystrophy 2B 74 0.0170363311059654
pediatric high grade glioma 2712 0.0184880564032709
glioblastoma 5572 0.0202876064779787
interstitial lung disease 292 0.0204734320274548
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.020841080451014
non primary Sjogren syndrome sicca 840 0.022482045576769
pancreatic carcinoma 567 0.0227529490945321
Bipolar Disorder 266 0.0275651349314081
head and neck cancer 270 0.0277038459798763
type II diabetes mellitus and post-ischemic heart failure 89 0.0315210079662502
aldosterone-producing adenoma 664 0.0377245641776348
heterozygous familial hypercholesterolemia 1 0.039674348725411

Expression

  Differential Expression (43)

Disease log2 FC p
Rheumatoid Arthritis 3.700 0.001
pancreatic cancer 2.600 0.003
interstitial lung disease -2.200 0.020
urothelial carcinoma -2.600 0.005
glioblastoma 1.700 0.020
osteosarcoma 1.460 0.008
chronic lymphosyte leukemia -1.400 0.000
posterior fossa group A ependymoma 2.400 0.000
non diabetic and post-ischemic heart fai... -1.500 0.002
type II diabetes mellitus and post-ische... -1.400 0.032
periodontitis 1.200 0.000
atypical teratoid / rhabdoid tumor 1.600 0.011
medulloblastoma, large-cell -1.300 0.010
Duchenne muscular dystrophy 1.120 0.008
juvenile dermatomyositis 1.033 0.000
limb girdle muscular dystrophy 2B 1.115 0.017
acute quadriplegic myopathy 1.692 0.014
Atopic dermatitis 1.800 0.000
adrenocortical carcinoma -1.827 0.012
primary pancreatic ductal adenocarcinoma 2.481 0.002
tuberculosis and treatment for 3 months -1.600 0.002
non-small cell lung cancer -1.788 0.000
intraductal papillary-mucinous adenoma (... -2.600 0.002
intraductal papillary-mucinous carcinoma... -2.100 0.021
lung cancer -2.800 0.000
ulcerative colitis 4.800 0.000
interstitial cystitis 4.000 0.000
cystic fibrosis 2.600 0.000
pediatric high grade glioma 1.500 0.018
pilocytic astrocytoma 2.500 0.000
non primary Sjogren syndrome sicca -1.200 0.022
pancreatic carcinoma 1.500 0.023
aldosterone-producing adenoma -2.595 0.038
psoriasis -3.000 0.000
invasive ductal carcinoma -1.371 0.002
lung carcinoma -2.100 0.000
heterozygous familial hypercholesterolem... 1.008 0.040
gastric carcinoma 3.800 0.003
Bipolar Disorder 1.002 0.028
ovarian cancer 2.300 0.001
Breast cancer 1.200 0.001
pituitary cancer -4.000 0.000
head and neck cancer 2.100 0.028

Synonym

Accession O14543 O14509 SOCS-3
Symbols CIS3
SSI3
ATOD4
Cish3
SSI-3
SOCS-3

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 GO Component (2)

Gene RIF (316)

PMID Text
26990535 miR-203 and miR-221 regulate SOCS1 and SOCS3 in essential thrombocythemia
26812031 Increased SOCS3 expression in PBMCs and T cells from patients with ankylosing spondylitis correlates with patient's functional ability, acute-phase reactants and serum pro-inflammatory cytokines.
26707189 Treatment of isolinderalactone increased the protein level of SCOS3, decreased phosphorylation of the STAT3 and suppressed expression of the down-stream genes of the X-linked inhibitor of apoptosis protein
26668321 Data suggest that PCSK9 is involved in regulation of lipid metabolism in hepatocytes by proinflammatory cytokine TNFalpha; induction of lipogenesis and insulin resistance in liver (as seen in obesity) involves up-regulation of both PCSK9 and SOCS3.
26485275 Decreased SOCS3 expression is associated with cholangiocarcinoma.
26464723 A significant relevance involved in SOCS3 gene polymorphisms and infantile asthma development based on a Chinese Han population.
26447993 Our findings suggest that the rs4969170A>G polymorphism of SOCS3 gene may be used as a prognostic predictor for HCC patients who underwent surgical treatment.
26429311 Dysregulation of SOCS3 functions can cause a variety of diseases, including allergy, autoimmune diseases, inflammation and cancer. (Review)
26416445 induction of SOCS3 may be a novel mechanism by which FXR exerts its anti-hepatocellular carcinoma effects
26393582 In hepatocellular carcinoma tumor tissues, SOCS3 showed an increased methylation frequency and intensity compared with that in the adjacent non-tumor tissues.
More...

AA Sequence

MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLI      1 - 70
RDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPP     71 - 140
TEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQL    141 - 210
PGPIREFLDQYDAPL                                                           211 - 225
//

Text Mined References (350)

PMID Year Title
26990535 2016 miR-203 and miR-221 regulate SOCS1 and SOCS3 in essential thrombocythemia.
26812031 Suppressors of cytokine signalling in ankylosing spondylitis and their associations with disease severity, acute-phase reactants and serum cytokines.
26707189 2016 Isolinderalactone enhances the inhibition of SOCS3 on STAT3 activity by decreasing miR-30c in breast cancer.
26668321 2016 Suppressor of Cytokine Signaling-3 (SOCS-3) Induces Proprotein Convertase Subtilisin Kexin Type 9 (PCSK9) Expression in Hepatic HepG2 Cell Line.
26485275 2015 The Prognostic Role of SOCS3 and A20 in Human Cholangiocarcinoma.
26464723 2015 Genetic correlation of SOCS3 polymorphisms with infantile asthma: an evidence based on a case-control study.
26447993 2015 SOCS3 Genetic Polymorphism Is Associated With Clinical Features and Prognosis of Hepatocellular Carcinoma Patients Receiving Hepatectomy.
26429311 2015 SOCS3 and its role in associated diseases.
26416445 2015 FXR induces SOCS3 and suppresses hepatocellular carcinoma.
26393582 2015 SOCS3 Methylation Predicts a Poor Prognosis in HBV Infection-Related Hepatocellular Carcinoma.
More...