Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $78,425.11
PubMed Score 17.28
PubTator Score 10.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
permanent atrial fibrillation 1.100 0.000
osteosarcoma 1.393 0.000
group 4 medulloblastoma 3.200 0.000
cystic fibrosis -1.276 0.000
atypical teratoid / rhabdoid tumor -1.400 0.002
subependymal giant cell astrocytoma -1.865 0.022

Gene RIF (2)

PMID Text
20499313 DPYSL4 is a novel apoptosis-inducible factor controlled by p53 in response to DNA damage
11771764 Aberrant expression of dihydropyrimidinase related proteins-2,-3 and -4 in fetal Down syndrome brain.

AA Sequence

MSFQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGENLIVPGGIKTIDAHGLMVLPGGV      1 - 70
DVHTRLQMPVLGMTPADDFCQGTKAALAGGTTMILDHVFPDTGVSLLAAYEQWRERADSAACCDYSLHVD     71 - 140
ITRWHESIKEELEALVKEKGVNSFLVFMAYKDRCQCSDSQMYEIFSIIRDLGALAQVHAENGDIVEEEQK    141 - 210
RLLELGITGPEGHVLSHPEEVEAEAVYRAVTIAKQANCPLYVTKVMSKGAADAIAQAKRRGVVVFGEPIT    211 - 280
ASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCTFTTAQKAVGKDNFAL    281 - 350
IPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPKATKII    351 - 420
SAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVYKRIKARNRLAE    421 - 490
IHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIMA    491 - 560
PPGGRSNITSLS                                                              561 - 572
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25358863 2014 Amino- and carboxyl-terminal domains of Filamin-A interact with CRMP1 to mediate Sema3A signalling.
20499313 2011 Identification of dihydropyrimidinase-related protein 4 as a novel target of the p53 tumor suppressor in the apoptotic response to DNA damage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11771764 2001 Aberrant expression of dihydropyrimidinase related proteins-2,-3 and -4 in fetal Down syndrome brain.
10956643 2000 Molecular characterization of CRMP5, a novel member of the collapsin response mediator protein family.
10851247 2000 Identification of CRAM, a novel unc-33 gene family protein that associates with CRMP3 and protein-tyrosine kinase(s) in the developing rat brain.
10594648 1999 Ulip/CRMP proteins are recognized by autoantibodies in paraneoplastic neurological syndromes.
More...