Property Summary

NCBI Gene PubMed Count 13
Grant Count 59
R01 Count 44
Funding $6,048,911
PubMed Score 150.35
PubTator Score 8.64

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O14530 B2R9G8 D3DVI4 Q53HG4 Q53RV8 Q6NSF5 Q8TB70 Q9BRU6
Symbols APACD
PHLP3

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
23210642 These findings suggest that TXNDC9 gene may function in colorectalcancer development
22174782 PhLP3 is important for the maintenance of beta-tubulin levels in mammalian cells.
16415341 antagonistic actions of PhLP3 and prefoldin serve to modulate CCT activity and play a key role in establishing a functional cytoskeleton in vivo

AA Sequence

MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGH      1 - 70
GEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHI     71 - 140
KVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLE    141 - 210
KKTIRGKKYDSDSDDD                                                          211 - 226
//

Text Mined References (21)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
23210642 2012 TXNDC9 expression in colorectal cancer cells and its influence on colorectal cancer prognosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22174782 2011 Modulation of phosducin-like protein 3 (PhLP3) levels promotes cytoskeletal remodelling in a MAPK and RhoA-dependent manner.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...