Property Summary

NCBI Gene PubMed Count 13
PubMed Score 166.64
PubTator Score 8.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (3)

AA Sequence

MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGH      1 - 70
GEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHI     71 - 140
KVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLE    141 - 210
KKTIRGKKYDSDSDDD                                                          211 - 226
//

Text Mined References (21)

PMID Year Title