Property Summary

NCBI Gene PubMed Count 15
PubMed Score 52.96
PubTator Score 54.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -4.700 6.9e-06
astrocytic glioma -2.700 5.3e-03
Astrocytoma, Pilocytic -5.200 8.3e-11
atypical teratoid / rhabdoid tumor -2.600 7.1e-03
Breast cancer -1.100 1.7e-04
cystic fibrosis -2.700 3.6e-05
ependymoma -3.100 2.7e-05
glioblastoma -4.300 1.3e-09
lung cancer 2.900 1.5e-03
medulloblastoma, large-cell -3.700 7.6e-04
oligodendroglioma -1.800 1.4e-07
osteosarcoma -2.424 2.9e-05
ovarian cancer -2.200 5.7e-06
pancreatic ductal adenocarcinoma liver m... -1.922 7.5e-04
pituitary cancer -1.700 2.5e-03
psoriasis -1.200 1.1e-03

Gene RIF (4)

AA Sequence

MAANVGSMFQYWKRFDLRRLQKELNSVASELSARQEESEHSHKHLIELRREFKKNVPEEIREMVAPVLKS      1 - 70
FQAEVVALSKRSQEAEAAFLSVYKQLIEAPDPVPVFEAARSLDDRLQPPSFDPSGQPRRDLHTSWKRNPE     71 - 140
LLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVL    141 - 210
HSALKATQAELLELRRKYDEEAASKADEVGLIMTNLEKANQRAEAAQREVESLREQLASVNSSIRLACCS    211 - 280
PQGPSGDKVNFTLCSGPRLEAALASKDREILRLLKDVQHLQSSLQELEEASANQIADLERQLTAKSEAIE    281 - 350
KLEEKLQAQSDYEEIKTELSILKAMKLASSTCSLPQGMAKPEDSLLIAKEAFFPTQKFLLEKPSLLASPE    351 - 420
EDPSEDDSIKDSLGTEQSYPSPQQLPPPPGPEDPLSPSPGQPLLGPSLGPDGTRTFSLSPFPSLASGERL    421 - 490
MMPPAAFKGEAGGLLVFPPAFYGAKPPTAPATPAPGPEPLGGPEPADGGGGGAAGPGAEEEQLDTAEIAF    491 - 560
QVKEQLLKHNIGQRVFGHYVLGLSQGSVSEILARPKPWRKLTVKGKEPFIKMKQFLSDEQNVLALRTIQV    561 - 630
RQRGSITPRIRTPETGSDDAIKSILEQAKKEIESQKGGEPKTSVAPLSIANGTTPASTSEDAIKSILEQA    631 - 700
RREMQAQQQALLEMEVAPRGRSVPPSPPERPSLATASQNGAPALVKQEEGSGGPAQAPLPVLSPAAFVQS    701 - 770
IIRKVKSEIGDAGYFDHHWASDRGLLSRPYASVSPSLSSSSSSGYSGQPNGRAWPRGDEAPVPPEDEAAA    771 - 840
GAEDEPPRTGELKAEGATAEAGARLPYYPAYVPRTLKPTVPPLTPEQYELYMYREVDTLELTRQVKEKLA    841 - 910
KNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLSDQLGQAVGQQPGASQASPTE    911 - 980
PRSSPSPPPSPTEPEKSSQEPLSLSLESSKENQQPEGRSSSSLSGKMYSGSQAPGGIQEIVAMSPELDTY    981 - 1050
SITKRVKEVLTDNNLGQRLFGESILGLTQGSVSDLLSRPKPWHKLSLKGREPFVRMQLWLNDPHNVEKLR   1051 - 1120
DMKKLEKKAYLKRRYGLISTGSDSESPATRSECPSPCLQPQDLSLLQIKKPRVVLAPEEKEALRKAYQLE   1121 - 1190
PYPSQQTIELLSFQLNLKTNTVINWFHNYRSRMRREMLVEGTQDEPDLDPSGGPGILPPGHSHPDPTPQS   1191 - 1260
PDSETEDQKPTVKELELQEGPEENSTPLTTQDKAQVRIKQEQMEEDAEEEAGSQPQDSGELDKGQGPPKE   1261 - 1330
EHPDPPGNDGLPKVAPGPLLPGGSTPDCPSLHPQQESEAGERLHPDPLSFKSASESSRCSLEVSLNSPSA   1331 - 1400
ASSPGLMMSVSPVPSSSAPISPSPPGAPPAKVPSASPTADMAGALHPSAKVNPNLQRRHEKMANLNNIIY   1401 - 1470
RVERAANREEALEWEF                                                         1471 - 1486
//

Text Mined References (18)

PMID Year Title