Property Summary

NCBI Gene PubMed Count 11
Grant Count 13
R01 Count 13
Funding $1,124,227.36
PubMed Score 6.19
PubTator Score 2.74

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -1.347 0.000
ependymoma -1.200 0.000
adult high grade glioma -1.200 0.000

Gene RIF (4)

PMID Text
25303365 The central linker of FCHO proteins acts as an allosteric regulator of the prime endocytic adaptor, AP-2.
22484487 show that the mu-homology domain of FCHO1/2 represents an endocytic interaction hub
20448150 study reports FCHo1/2 were required for plasma membrane clathrin-coated vesicle (CCV) budding & marked sites of CCV formation
17617719 Involved in clathrin-coated vesicle formation.

AA Sequence

MSYFGEHFWGEKNHGFEVLYHSVKQGPISTKELADFIRERATIEETYSKAMAKLSKLASNGTPMGTFAPL      1 - 70
WEVFRVSSDKLALCHLELTRKLQDLIKDVLRYGEEQLKTHKKCKEEVVSTLDAVQVLSGVSQLLPKSREN     71 - 140
YLNRCMDQERLRRESTSQKEMDKAETKTKKAAESLRRSVEKYNSARADFEQKMLDSALRFQAMEETHLRH    141 - 210
MKALLGSYAHSVEDTHVQIGQVHEEFKQNIENVSVEMLLRKFAESKGTGREKPGPLDFEAYSAAALQEAM    211 - 280
KRLRGAKAFRLPGLSRREREPEPPAAVDFLEPDSGTCPEVDEEGFTVRPDVTQNSTAEPSRFSSSDSDFD    281 - 350
DEEPRKFYVHIKPAPARAPACSPEAAAAQLRATAGSLILPPGPGGTMKRHSSRDAAGKPQRPRSAPRTSS    351 - 420
CAERLQSEEQVSKNLFGPPLESAFDHEDFTGSSSLGFTSSPSPFSSSSPENVEDSGLDSPSHAAPGPSPD    421 - 490
SWVPRPGTPQSPPSCRAPPPEARGIRAPPLPDSPQPLASSPGPWGLEALAGGDLMPAPADPTAREGLAAP    491 - 560
PRRLRSRKVSCPLTRSNGDLSRSLSPSPLGSSAASTALERPSFLSQTGHGVSRGPSPVVLGSQDALPIAT    561 - 630
AFTEYVHAYFRGHSPSCLARVTGELTMTFPAGIVRVFSGTPPPPVLSFRLVHTTAIEHFQPNADLLFSDP    631 - 700
SQSDPETKDFWLNMAALTEALQRQAEQNPTASYYNVVLLRYQFSRPGPQSVPLQLSAHWQCGATLTQVSV    701 - 770
EYGYRPGATAVPTPLTNVQILLPVGEPVTNVRLQPAATWNLEEKRLTWRLPDVSEAGGSGRLSASWEPLS    771 - 840
GPSTPSPVAAQFTSEGTTLSGVDLELVGSGYRMSLVKRRFATGMYLVSC                         841 - 889
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25303365 2014 A clathrin coat assembly role for the muniscin protein central linker revealed by TALEN-mediated gene editing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
20448150 2010 FCHo proteins are nucleators of clathrin-mediated endocytosis.
19713939 2009 Syp1 is a conserved endocytic adaptor that contains domains involved in cargo selection and membrane tubulation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17617719 2007 Dynamic behavior of FCHO1 revealed by live-cell imaging microscopy: its possible involvement in clathrin-coated vesicle formation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
More...