Property Summary

NCBI Gene PubMed Count 12
Grant Count 3
R01 Count 3
Funding $582,326.34
PubMed Score 17.94
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 0.022
psoriasis -1.700 0.000
posterior fossa group A ependymoma -2.100 0.000
sonic hedgehog group medulloblastoma -3.000 0.000
astrocytoma 1.100 0.049
atypical teratoid / rhabdoid tumor -4.200 0.000
glioblastoma -1.500 0.027
medulloblastoma, large-cell -3.400 0.000
primitive neuroectodermal tumor -1.100 0.025
pediatric high grade glioma -1.200 0.018
invasive ductal carcinoma -1.258 0.003
Pick disease -1.300 0.002
ovarian cancer -2.300 0.000
pituitary cancer 1.200 0.003

Synonym

Accession O14525 A5PL12 B4DHI9 E9PFR8 O60799 Q5W0V7 Q5W0V8
Symbols ASTN

Gene

Gene RIF (5)

PMID Text
22488871 Family-based association analysis shows the ASTN1 gene significantly associated with alcohol dependence.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18384059 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALAGLCALLACCWGPAAVLATAAGDVDPSKELECKLKSITVSALPFLRENDLSIMHSPSASEPKLLFSV      1 - 70
RNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLFHIHHQDGAPSLPGQDPTEEP     71 - 140
QHESAEEELRILHISVMGGMIALLLSILCLVMILYTRRRWCKRRRVPQPQKSASAEAANEIHYIPSVLIG    141 - 210
GHGRESLRNARVQGHNSSGTLSIRETPILDGYEYDITDLRHHLQRECMNGGEDFASQVTRTLDSLQGCNE    211 - 280
KSGMDLTPGSDNAKLSLMNKYKDNIIATSPVDSNHQQATLLSHTSSSQRKRINNKARAGSAFLNPEGDSG    281 - 350
TEAENDPQLTFYTDPSRSRRRSRVGSPRSPVNKTTLTLISITSCVIGLVCSSHVNCPLVVKITLHVPEHL    351 - 420
IADGSRFILLEGSQLDASDWLNPAQVVLFSQQNSSGPWAMDLCARRLLDPCEHQCDPETGRREHRAAGEC    421 - 490
LCYEGYMKDPVHKHLCIRNEWGTNQGPWPYTIFQRGFDLVLGEQPSDKIFRFTYTLGEGMWLPLSKSFVI    491 - 560
PPAELAINPSAKCKTDMTVMEDAVEVREELMTSSSFDSLEVLLDSFGPVRDCSKDNGGCSKNFRCISDRK    561 - 630
LDSTGCVCPSGLSPMKDSSGCYDRHIGVDCSDGFNGGCEQLCLQQMAPFPDDPTLYNILMFCGCIEDYKL    631 - 700
GVDGRSCQLITETCPEGSDCGESRELPMNQTLFGEMFFGYNNHSKEVAAGQVLKGTFRQNNFARGLDQQL    701 - 770
PDGLVVATVPLENQCLEEISEPTPDPDFLTGMVNFSEVSGYPVLQHWKVRSVMYHIKLNQVAISQALSNA    771 - 840
LHSLDGATSRADFVALLDQFGNHYIQEAIYGFEESCSIWYPNKQVQRRLWLEYEDISKGNSPSDESEERE    841 - 910
RDPKVLTFPEYITSLSDSGTKHMAAGVRMECHSKGRCPSSCPLCHVTSSPDTPAEPVLLEVTKAAPIYEL    911 - 980
VTNNQTQRLLQEATMSSLWCSGTGDVIEDWCRCDSTAFGADGLPTCAPLPQPVLRLSTVHEPSSTLVVLE    981 - 1050
WEHSEPPIGVQIVDYLLRQEKVTDRMDHSKVETETVLSFVDDIISGAKSPCAMPSQVPDKQLTTISLIIR   1051 - 1120
CLEPDTIYMFTLWGVDNTGRRSRPSDVIVKTPCPVVDDVKAQEIADKIYNLFNGYTSGKEQQTAYNTLLD   1121 - 1190
LGSPTLHRVLYHYNQHYESFGEFTWRCEDELGPRKAGLILSQLGDLSSWCNGLLQEPKISLRRSSLKYLG   1191 - 1260
CRYSEIKPYGLDWAELSRDLRKTCEEQTLSIPYNDYGDSKEI                               1261 - 1302
//

Text Mined References (14)

PMID Year Title
22488871 2012 ASTN1 and alcohol dependence: family-based association analysis in multiplex alcohol dependence families.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18384059 2008 Association analysis of schizophrenia on 18 genes involved in neuronal migration: MDGA1 as a new susceptibility gene.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...