Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 3.86068399723188E-13
malignant mesothelioma 3163 7.44196038251877E-8
atypical teratoid / rhabdoid tumor 4369 1.22201805955264E-7
medulloblastoma, large-cell 6234 2.18043643029257E-6
group 3 medulloblastoma 2254 3.19346354794306E-6
nasopharyngeal carcinoma 1056 6.48409453791516E-6
glioblastoma 5572 1.86363291106247E-5
psoriasis 6685 2.22441869606721E-5
pediatric high grade glioma 2712 3.99816060379585E-5
lung cancer 4473 6.57371899105246E-5
adrenocortical carcinoma 1427 7.12424864952005E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00213156258986577
primitive neuroectodermal tumor 3031 0.00316238075112595
tuberculosis and treatment for 6 months 686 0.00354405136539697
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00446941253584396
astrocytoma 1493 0.00944854758379804
osteosarcoma 7933 0.0162779538466357

Expression

Synonym

Accession O14524 Q17R72 Q68DH0 Q6IQ25
Symbols TMEM194
TMEM194A

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Xenopus OMA Inparanoid

Pathway (1)

AA Sequence

MAGGMKVAVSPAVGPGPWGSGVGGGGTVRLLLILSGCLVYGTAETDVNVVMLQESQVCEKRASQQFCYTN      1 - 70
VLIPKWHDIWTRIQIRVNSSRLVRVTQVENEEKLKELEQFSIWNFFSSFLKEKLNDTYVNVGLYSTKTCL     71 - 140
KVEIIEKDTKYSVIVIRRFDPKLFLVFLLGLMLFFCGDLLSRSQIFYYSTGMTVGIVASLLIIIFILSKF    141 - 210
MPKKSPIYVILVGGWSFSLYLIQLVFKNLQEIWRCYWQYLLSYVLTVGFMSFAVCYKYGPLENERSINLL    211 - 280
TWTLQLMGLCFMYSGIQIPHIALAIIIIALCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQ    281 - 350
GEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIY    351 - 420
EEASSEEEDSYSRCPAITQNNFLT                                                  421 - 444
//

Text Mined References (11)

PMID Year Title
25946333 2015 The Inner Nuclear Membrane Protein Nemp1 Is a New Type of RanGTP-Binding Protein in Eukaryotes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
More...