Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.347 3.1e-03
adult high grade glioma 1.100 4.2e-03
astrocytoma 1.200 9.4e-03
atypical teratoid / rhabdoid tumor 2.600 1.2e-07
glioblastoma 1.500 2.7e-05
group 3 medulloblastoma 2.300 3.2e-06
intraductal papillary-mucinous carcinoma... 1.400 2.1e-03
intraductal papillary-mucinous neoplasm ... 1.700 4.5e-03
lung cancer 1.400 6.6e-05
malignant mesothelioma 1.400 9.1e-07
medulloblastoma, large-cell 3.000 2.2e-06
nasopharyngeal carcinoma 1.800 6.5e-06
non-small cell lung cancer 1.096 3.9e-13
osteosarcoma -1.380 1.6e-02
primitive neuroectodermal tumor 1.200 3.2e-03
psoriasis -1.100 2.5e-06
tuberculosis -1.200 4.8e-05

Gene RIF (1)

AA Sequence

MAGGMKVAVSPAVGPGPWGSGVGGGGTVRLLLILSGCLVYGTAETDVNVVMLQESQVCEKRASQQFCYTN      1 - 70
VLIPKWHDIWTRIQIRVNSSRLVRVTQVENEEKLKELEQFSIWNFFSSFLKEKLNDTYVNVGLYSTKTCL     71 - 140
KVEIIEKDTKYSVIVIRRFDPKLFLVFLLGLMLFFCGDLLSRSQIFYYSTGMTVGIVASLLIIIFILSKF    141 - 210
MPKKSPIYVILVGGWSFSLYLIQLVFKNLQEIWRCYWQYLLSYVLTVGFMSFAVCYKYGPLENERSINLL    211 - 280
TWTLQLMGLCFMYSGIQIPHIALAIIIIALCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQ    281 - 350
GEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIY    351 - 420
EEASSEEEDSYSRCPAITQNNFLT                                                  421 - 444
//

Text Mined References (11)

PMID Year Title