Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.70
PubTator Score 1.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 5.6e-05
Astrocytoma, Pilocytic -1.100 1.7e-07
atypical teratoid/rhabdoid tumor -1.200 6.6e-09
ependymoma -1.300 2.0e-16
glioblastoma -1.100 8.3e-10
malignant mesothelioma 1.500 2.5e-06
osteosarcoma -1.931 3.8e-07
psoriasis -1.600 3.7e-04
sonic hedgehog group medulloblastoma -1.100 1.5e-05
tuberculosis 1.100 8.6e-04

Gene RIF (2)

AA Sequence

MDPGWGQRDVGWAALLILFAASLLTVFAWLLQYARGLWLARARGDRGPGPALAGEPAGSLRELGVWRSLL      1 - 70
RLRATRAGAAEEPGVRGLLASLFAFKSFRENWQRAWVRALNEQACRNGSSIQIAFEEVPQLPPRASISHV     71 - 140
TCVDQSEHTMVLRCQLSAEEVRFPVSVTQQSPAAVSMETYHVTLTLPPTQLEVNLEEIPGEGLLISWAFT    141 - 210
DRPDLSLTVLPKLQARERGEEQVELSTIEELIKDAIVSTQPAMMVNLRACSAPGGLVPSEKPPMMPQAQP    211 - 280
AIPRPNRLFLRQLRASHLGNELEGTEELCCVAELDNPMQQKWTKPARAGSEVEWTEDLALDLGPQSRELT    281 - 350
LKVLRSSSCGDTELLGQATLPVGSPSRPLSRRQLCPLTPGPGKALGPAATMAVELHYEEGSPRNLGTPTS    351 - 420
STPRPSITPTKKIELDRTIMPDGTIVTTVTTVQSRPRIDGKLDSPSRSPSKVEVTEKTTTVLSESSGPSN    421 - 490
TSHSSSRDSHLSNGLDPVAETAIRQLTEPSGRVAKKTPTKRSTLIISGVSKVPIAQDELALSLGYAASLE    491 - 560
ASVQDDAGTSGGPSSPPSDPPAMSPGPLDALSSPTSVQEADETTRSDISERPSVDDIESETGSTGALETR    561 - 630
SLKDHKVSFLRSGTKLIFRRRPRQKEAGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANG    631 - 700
NPSPQL                                                                    701 - 706
//

Text Mined References (13)

PMID Year Title