Property Summary

NCBI Gene PubMed Count 33
Grant Count 14
R01 Count 11
Funding $1,272,443.43
PubMed Score 21.53
PubTator Score 31.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma multiforme -1.600 0.000
osteosarcoma 1.200 0.000
ependymoma -1.800 0.000
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma, large-cell -1.900 0.001
primitive neuroectodermal tumor -1.900 0.024
fibroadenoma 2.400 0.010
adult high grade glioma -1.400 0.001
pilocytic astrocytoma -1.700 0.000
Pick disease -1.100 0.028
ovarian cancer 1.100 0.000
psoriasis -1.100 0.000

Gene RIF (16)

PMID Text
25982282 PTPRT promoter methylation is significantly associated with sensitivity to STAT3 inhibition in HNSCC cells, suggesting that PTPRT promoter methylation may serve as a predictive biomarker for responsiveness to STAT3 inhibitors in clinical development
25967969 Data reported evidence that rs2866943 polymorphism in PTPRT 3'-UTR was involved in the occurrence of esophageal squamous cell carcinoma by acting as a protective factor while rs6029959 acts as a risk factor.
24434140 Data show that hepatitis B virus X protein mutant HBxDelta127 enhances proliferation of hepatoma cells through up-regulating miR-215 targeting protein tyrosine phosphatase, receptor type T (PTPRT).
24395800 tumor-specific mutational events in the PTPRT gene can serve as direct drivers for tumor growth by inducing hyperactivation of STAT3, a potent oncogenic transcription factor and PTPRT substrate
22389709 The catalytic domain point mutants show a decreased thermal and thermodynamic stability and decreased activation energy relative to phosphatase activity, when compared to wild- type
21517784 [review] High-throughput mutational analysis identifies loss-of-function mutations in six PTPs in human colon cancers, providing critical cancer genetics evidence that PTPs can act as tumour suppressor genes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20133777 Data show that paxillin is a direct substrate of PTPRT and that PTPRT specifically regulates paxillin phosphorylation at tyrosine residue 88(Y88).
19816407 brain-specific PTPRT regulates synapse formation through interaction with cell adhesion molecules, and this function and the phosphatase activity are attenuated through tyrosine phosphorylation by the synaptic tyrosine kinase Fyn.
More...

AA Sequence

MASLAALALSLLLRLQLPPLPGARAQSAAGGCSFDEHYSNCGYSVALGTNGFTWEQINTWEKPMLDQAVP      1 - 70
TGSFMMVNSSGRASGQKAHLLLPTLKENDTHCIDFHYYFSSRDRSSPGALNVYVKVNGGPQGNPVWNVSG     71 - 140
VVTEGWVKAELAISTFWPHFYQVIFESVSLKGHPGYIAVDEVRVLAHPCRKAPHFLRLQNVEVNVGQNAT    141 - 210
FQCIAGGKWSQHDKLWLQQWNGRDTALMVTRVVNHRRFSATVSVADTAQRSVSKYRCVIRSDGGSGVSNY    211 - 280
AELIVKEPPTPIAPPELLAVGATYLWIKPNANSIIGDGPIILKEVEYRTTTGTWAETHIVDSPNYKLWHL    281 - 350
DPDVEYEIRVLLTRPGEGGTGPPGPPLTTRTKCADPVHGPQNVEIVDIRARQLTLQWEPFGYAVTRCHSY    351 - 420
NLTVQYQYVFNQQQYEAEEVIQTSSHYTLRGLRPFMTIRLRLLLSNPEGRMESEELVVQTEEDVPGAVPL    421 - 490
ESIQGGPFEEKIYIQWKPPNETNGVITLYEINYKAVGSLDPSADLSSQRGKVFKLRNETHHLFVGLYPGT    491 - 560
TYSFTIKASTAKGFGPPVTTRIATKISAPSMPEYDTDTPLNETDTTITVMLKPAQSRGAPVSVYQLVVKE    561 - 630
ERLQKSRRAADIIECFSVPVSYRNASSLDSLHYFAAELKPANLPVTQPFTVGDNKTYNGYWNPPLSPLKS    631 - 700
YSIYFQALSKANGETKINCVRLATKGASTQNSNTVEPEKQVDNTVKMAGVIAGLLMFIIILLGVMLTIKR    701 - 770
RRNAYSYSYYLKLAKKQKETQSGAQREMGPVASADKPTTKLSASRNDEGFSSSSQDVNGFTDGSRGELSQ    771 - 840
PTLTIQTHPYRTCDPVEMSYPRDQFQPAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKED    841 - 910
ENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENS    911 - 980
ASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSW    981 - 1050
PDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELR   1051 - 1120
AQRVNLVQTEEQYVFVHDAILEACLCGNTAIPVCEFRSLYYNISRLDPQTNSSQIKDEFQTLNIVTPRVR   1121 - 1190
PEDCSIGLLPRNHDKNRSMDVLPLDRCLPFLISVDGESSNYINAALMDSHKQPAAFVVTQHPLPNTVADF   1191 - 1260
WRLVFDYNCSSVVMLNEMDTAQFCMQYWPEKTSGCYGPIQVEFVSADIDEDIIHRIFRICNMARPQDGYR   1261 - 1330
IVQHLQYIGWPAYRDTPPSKRSLLKVVRRLEKWQEQYDGREGRTVVHCLNGGGRSGTFCAICSVCEMIQQ   1331 - 1400
QNIIDVFHIVKTLRNNKSNMVETLEQYKFVYEVALEYLSSF                                1401 - 1441
//

Text Mined References (37)

PMID Year Title
25982282 2016 Frequent promoter hypermethylation of PTPRT increases STAT3 activation and sensitivity to STAT3 inhibition in head and neck cancer.
25967969 2015 The Functional Variant in the 3'UTR of PTPRT with the Risk of Esophageal Squamous Cell Carcinoma in a Chinese Population.
24951543 2014 Meta-analysis of genome-wide association studies in multiethnic Asians identifies two loci for age-related nuclear cataract.
24434140 2014 Hepatitis B virus X protein mutant HBx?127 promotes proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT.
24395800 2014 Frequent mutation of receptor protein tyrosine phosphatases provides a mechanism for STAT3 hyperactivation in head and neck cancer.
24315451 2014 Fraction of exhaled nitric oxide values in childhood are associated with 17q11.2-q12 and 17q12-q21 variants.
24123876 2013 Identification of pathogenic gene variants in small families with intellectually disabled siblings by exome sequencing.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22389709 2012 Structural stability of human protein tyrosine phosphatase ? catalytic domain: effect of point mutations.
More...