Property Summary

NCBI Gene PubMed Count 34
PubMed Score 23.12
PubTator Score 31.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.400 9.3e-04
Astrocytoma, Pilocytic -1.700 5.5e-06
atypical teratoid / rhabdoid tumor -2.000 2.6e-05
ependymoma -1.800 5.7e-09
fibroadenoma 2.400 1.0e-02
glioblastoma -1.300 8.7e-04
group 3 medulloblastoma -2.100 3.3e-04
medulloblastoma, large-cell -1.900 8.7e-04
osteosarcoma 1.200 3.0e-05
ovarian cancer 1.100 4.0e-06
Pick disease -1.100 2.8e-02
primitive neuroectodermal tumor -1.900 2.4e-02
psoriasis -1.100 4.5e-32

Gene RIF (17)

AA Sequence

MASLAALALSLLLRLQLPPLPGARAQSAAGGCSFDEHYSNCGYSVALGTNGFTWEQINTWEKPMLDQAVP      1 - 70
TGSFMMVNSSGRASGQKAHLLLPTLKENDTHCIDFHYYFSSRDRSSPGALNVYVKVNGGPQGNPVWNVSG     71 - 140
VVTEGWVKAELAISTFWPHFYQVIFESVSLKGHPGYIAVDEVRVLAHPCRKAPHFLRLQNVEVNVGQNAT    141 - 210
FQCIAGGKWSQHDKLWLQQWNGRDTALMVTRVVNHRRFSATVSVADTAQRSVSKYRCVIRSDGGSGVSNY    211 - 280
AELIVKEPPTPIAPPELLAVGATYLWIKPNANSIIGDGPIILKEVEYRTTTGTWAETHIVDSPNYKLWHL    281 - 350
DPDVEYEIRVLLTRPGEGGTGPPGPPLTTRTKCADPVHGPQNVEIVDIRARQLTLQWEPFGYAVTRCHSY    351 - 420
NLTVQYQYVFNQQQYEAEEVIQTSSHYTLRGLRPFMTIRLRLLLSNPEGRMESEELVVQTEEDVPGAVPL    421 - 490
ESIQGGPFEEKIYIQWKPPNETNGVITLYEINYKAVGSLDPSADLSSQRGKVFKLRNETHHLFVGLYPGT    491 - 560
TYSFTIKASTAKGFGPPVTTRIATKISAPSMPEYDTDTPLNETDTTITVMLKPAQSRGAPVSVYQLVVKE    561 - 630
ERLQKSRRAADIIECFSVPVSYRNASSLDSLHYFAAELKPANLPVTQPFTVGDNKTYNGYWNPPLSPLKS    631 - 700
YSIYFQALSKANGETKINCVRLATKGASTQNSNTVEPEKQVDNTVKMAGVIAGLLMFIIILLGVMLTIKR    701 - 770
RRNAYSYSYYLKLAKKQKETQSGAQREMGPVASADKPTTKLSASRNDEGFSSSSQDVNGFTDGSRGELSQ    771 - 840
PTLTIQTHPYRTCDPVEMSYPRDQFQPAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKED    841 - 910
ENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENS    911 - 980
ASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSW    981 - 1050
PDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELR   1051 - 1120
AQRVNLVQTEEQYVFVHDAILEACLCGNTAIPVCEFRSLYYNISRLDPQTNSSQIKDEFQTLNIVTPRVR   1121 - 1190
PEDCSIGLLPRNHDKNRSMDVLPLDRCLPFLISVDGESSNYINAALMDSHKQPAAFVVTQHPLPNTVADF   1191 - 1260
WRLVFDYNCSSVVMLNEMDTAQFCMQYWPEKTSGCYGPIQVEFVSADIDEDIIHRIFRICNMARPQDGYR   1261 - 1330
IVQHLQYIGWPAYRDTPPSKRSLLKVVRRLEKWQEQYDGREGRTVVHCLNGGGRSGTFCAICSVCEMIQQ   1331 - 1400
QNIIDVFHIVKTLRNNKSNMVETLEQYKFVYEVALEYLSSF                                1401 - 1441
//

Text Mined References (38)

PMID Year Title