Property Summary

NCBI Gene PubMed Count 128
Grant Count 66
R01 Count 29
Funding $10,030,651.35
PubMed Score 334.25
PubTator Score 249.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.100 0.001
pancreatic ductal adenocarcinoma liver m... -1.367 0.025
Breast cancer 2.700 0.035
ovarian cancer 1.500 0.003

Synonym

Accession O14521 A6ND90 B3KQQ8 E9PIC0 E9PIG3 E9PQI9 Q53XW5 Q6IRW2 CybS
Symbols PGL
CBT1
CWS3
PGL1
QPs3
SDH4
cybS
CII-4

Gene

 GO Process (1)

Gene RIF (108)

PMID Text
26591561 Hereditary pheochromocytoma / paraganglioma associated with SDHD gene mutations has more aggressive course,bilateral adrenal involvement, higher recurrence rate, younger age at disease manifestations.
26522426 Loss of SDH activity leads to changes in the metabolism of non-essential amino acids.
26377099 significant association with overall survival were confirmed for SDHC gene, SDHD gene and FH gene ... SDHC gene and FH gene were the primary factors contributing to the different overall survival time of colorectal carcinoma
26327518 Melanomas harbor recurrent SDHD promoter mutations, which occur primarily as C>T alterations in UV-exposed melanomas.
26259135 This study strengthens the etiological association of SDH genes with pituitary neoplasia, renal tumorigenesis, and gastric gastrointestinal stromal tumors. Also, pancreatic neuroendocrine tumor falls within the SDH-related tumor spectrum.
26225774 Metabolic sensors via Sirt3 maximize the cellular reserve respiratory capacity through activating mitochondrial complex II, which enhances cell survival after hypoxia.
26113606 15 YEARS OF PARAGANGLIOMA: Genetics and mechanism of pheochromocytoma-paraganglioma syndromes characterized by germline SDHB and SDHD mutations
26008905 A recessive homozygous p.Asp92Gly SDHD mutation causes prenatal cardiomyopathy and a severe mitochondrial complex II deficiency
25973039 suggested that SDHD mutation may enhance the overexpression of miR-101 in malignant tumors and miR-101 may be a potential diagnostic biomarker for malignant pheochromocytoma and benign pheochromocytoma
25819804 Data indicate that double pathogenic mutations in the succinate dehydrogenase complex subunit D (SDHD) gene is associated with the aggressive paraganglioma syndrome type 1 (PGL1) phenotype.
More...

AA Sequence

MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSER      1 - 70
VVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLC     71 - 140
YFNYHDVGICKAVAMLWKL                                                       141 - 159
//

Text Mined References (135)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26591561 2015 [Hereditary pheochromocytoma-associated syndromes. Part 1].
26522426 2015 Loss of succinate dehydrogenase activity results in dependency on pyruvate carboxylation for cellular anabolism.
26377099 2015 Genetic variations in genes of metabolic enzymes predict postoperational prognosis of patients with colorectal cancer.
26327518 2015 Analysis of SDHD promoter mutations in various types of melanoma.
26259135 2015 Succinate Dehydrogenase (SDH)-Deficient Pancreatic Neuroendocrine Tumor Expands the SDH-Related Tumor Spectrum.
26225774 2015 Mitochondrial complex II is a source of the reserve respiratory capacity that is regulated by metabolic sensors and promotes cell survival.
26113606 2015 15 YEARS OF PARAGANGLIOMA: Genetics and mechanism of pheochromocytoma-paraganglioma syndromes characterized by germline SDHB and SDHD mutations.
26008905 2015 A recessive homozygous p.Asp92Gly SDHD mutation causes prenatal cardiomyopathy and a severe mitochondrial complex II deficiency.
25973039 2015 Role of miR-101 in pheochromocytoma patients with SDHD mutation.
More...