Tbio | Aquaporin-7 |
Forms a channel for water and glycerol.
This gene encodes a member of the aquaporin family of water-selective membrane channels. The encoded protein localizes to the plasma membrane and allows movement of water, glycerol and urea across cell membranes. This gene is highly expressed in the adipose tissue where the encoded protein facilitates efflux of glycerol. In the proximal straight tubules of kidney, the encoded protein is localized to the apical membrane and prevents excretion of glycerol into urine. The encoded protein is present in spermatids, as well as in the testicular and epididymal spermatozoa suggesting an important role in late spermatogenesis. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. This gene is located adjacent to a related aquaporin gene on chromosome 9. Multiple pseudogenes of this gene have been identified. [provided by RefSeq, Dec 2015]
This gene encodes a member of the aquaporin family of water-selective membrane channels. The encoded protein localizes to the plasma membrane and allows movement of water, glycerol and urea across cell membranes. This gene is highly expressed in the adipose tissue where the encoded protein facilitates efflux of glycerol. In the proximal straight tubules of kidney, the encoded protein is localized to the apical membrane and prevents excretion of glycerol into urine. The encoded protein is present in spermatids, as well as in the testicular and epididymal spermatozoa suggesting an important role in late spermatogenesis. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. This gene is located adjacent to a related aquaporin gene on chromosome 9. Multiple pseudogenes of this gene have been identified. [provided by RefSeq, Dec 2015]
Comments
Disease | Target Count |
---|---|
Obesity | 616 |
Liver Cirrhosis, Experimental | 108 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Brain edema | 26 | 4.165 | 2.1 |
Nephrogenic diabetes insipidus | 13 | 3.453 | 1.7 |
Chronic closed-angle glaucoma | 2 | 3.019 | 1.5 |
PMID | Text |
---|---|
26313002 | the human aquaglyceroporins, i.e., AQP3, AQP7, AQP9 and AQP10 can act as silicon transporters in both Xenopus laevis oocytes and HEK-293 cells. |
24463099 | REVIEW: the current knowledge on the role of the glycerol channels AQP7 and AQP9 in controlling glycerol metabolism in adipose tissue and liver |
24376702 | a direct involvement of AQP7 in water and glycerol transport |
24334538 | AQP7-specific glycerol transport was furthermore found to be specifically inhibited. |
23290745 | AQP7 is expressed in human and mouse oocytes and upregulated by cryoprotectants. |
23235401 | AQP7 overexpression may be related to insulin sensitivity and glucose homeostasis in women with the polycystic ovary syndrome. |
23001483 | AQP7 is regulated in response to physical training in a gender-dependent manner in adipose tissue. |
22899094 | The discovery of an association between urine glycerol loss and a platelet secretion defect is a novel one, and our findings imply the involvement of AQPs in platelet secretion. |
22425521 | There is a coordinated regulation of adipose AQP7 and hepatic AQP9 gene expression that is distorted in metabolic syndrome X. |
22206455 | In all of the 33 investigated semen samples, we observed AQP7 binding to the sperm sur-face with different intensity and modality. |
More... |
MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGV 1 - 70 NLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILH 71 - 140 FSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILV 141 - 210 VIIGVSLGMNTGYAINPSRDLPPRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTI 211 - 280 PREPLKLEDSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF 281 - 342 //
PMID | Year | Title |
---|---|---|
26313002 | 2015 | Aquaporins Mediate Silicon Transport in Humans. |
24463099 | 2014 | Metabolic impact of the glycerol channels AQP7 and AQP9 in adipose tissue and liver. |
24376702 | 2013 | Biophysical assessment of human aquaporin-7 as a water and glycerol channel in 3T3-L1 adipocytes. |
24334538 | 2014 | Functional characteristics of aquaporin 7 as a facilitative glycerol carrier. |
23290745 | 2013 | Cryoprotectants up-regulate expression of mouse oocyte AQP7, which facilitates water diffusion during cryopreservation. |
23235401 | 2013 | Aquaglyceroporin-7 overexpression in women with the polycystic ovary syndrome. |
23001483 | 2012 | Gender-specific effect of physical training on AQP7 protein expression in human adipose tissue. |
22899094 | 2013 | Homozygosity for aquaporin 7 G264V in three unrelated children with hyperglyceroluria and a mild platelet secretion defect. |
22425521 | Implications of aquaglyceroporins 7 and 9 in glycerol metabolism and metabolic syndrome. | |
22206455 | 2012 | Immunolocalization of aquaporin 7 in human sperm and its relationship with semen parameters. |
More... |