Property Summary

NCBI Gene PubMed Count 55
PubMed Score 165.71
PubTator Score 61.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Obesity 678 3.849 1.9
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.2e-19
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Brain Edema 50 4.322 2.2
Nephrogenic Diabetes Insipidus 16 3.41 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 2.2e-19

Gene RIF (23)

AA Sequence

MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGV      1 - 70
NLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILH     71 - 140
FSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILV    141 - 210
VIIGVSLGMNTGYAINPSRDLPPRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTI    211 - 280
PREPLKLEDSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF            281 - 342
//

Text Mined References (56)

PMID Year Title