Property Summary

NCBI Gene PubMed Count 51
Grant Count 6
R01 Count 5
Funding $1,213,381.5
PubMed Score 153.64
PubTator Score 61.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Synonym

Accession O14520 Q08E94 Q5T5L9 Q8NHM3 AQP-7
Symbols AQP7L
AQPap
GLYCQTL

Gene

PANTHER Protein Class (1)

Gene RIF (20)

PMID Text
26313002 the human aquaglyceroporins, i.e., AQP3, AQP7, AQP9 and AQP10 can act as silicon transporters in both Xenopus laevis oocytes and HEK-293 cells.
24463099 REVIEW: the current knowledge on the role of the glycerol channels AQP7 and AQP9 in controlling glycerol metabolism in adipose tissue and liver
24376702 a direct involvement of AQP7 in water and glycerol transport
24334538 AQP7-specific glycerol transport was furthermore found to be specifically inhibited.
23290745 AQP7 is expressed in human and mouse oocytes and upregulated by cryoprotectants.
23235401 AQP7 overexpression may be related to insulin sensitivity and glucose homeostasis in women with the polycystic ovary syndrome.
23001483 AQP7 is regulated in response to physical training in a gender-dependent manner in adipose tissue.
22899094 The discovery of an association between urine glycerol loss and a platelet secretion defect is a novel one, and our findings imply the involvement of AQPs in platelet secretion.
22425521 There is a coordinated regulation of adipose AQP7 and hepatic AQP9 gene expression that is distorted in metabolic syndrome X.
22206455 In all of the 33 investigated semen samples, we observed AQP7 binding to the sperm sur-face with different intensity and modality.
More...

AA Sequence

MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGV      1 - 70
NLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILH     71 - 140
FSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILV    141 - 210
VIIGVSLGMNTGYAINPSRDLPPRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTI    211 - 280
PREPLKLEDSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF            281 - 342
//

Text Mined References (52)

PMID Year Title
26313002 2015 Aquaporins Mediate Silicon Transport in Humans.
24463099 2014 Metabolic impact of the glycerol channels AQP7 and AQP9 in adipose tissue and liver.
24376702 2013 Biophysical assessment of human aquaporin-7 as a water and glycerol channel in 3T3-L1 adipocytes.
24334538 2014 Functional characteristics of aquaporin 7 as a facilitative glycerol carrier.
23290745 2013 Cryoprotectants up-regulate expression of mouse oocyte AQP7, which facilitates water diffusion during cryopreservation.
23235401 2013 Aquaglyceroporin-7 overexpression in women with the polycystic ovary syndrome.
23001483 2012 Gender-specific effect of physical training on AQP7 protein expression in human adipose tissue.
22899094 2013 Homozygosity for aquaporin 7 G264V in three unrelated children with hyperglyceroluria and a mild platelet secretion defect.
22425521 Implications of aquaglyceroporins 7 and 9 in glycerol metabolism and metabolic syndrome.
22206455 2012 Immunolocalization of aquaporin 7 in human sperm and its relationship with semen parameters.
More...