Property Summary

NCBI Gene PubMed Count 40
PubMed Score 111.12
PubTator Score 46.56

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

AA Sequence

MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAII      1 - 70
EELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS                              71 - 115
//

Text Mined References (41)

PMID Year Title