Property Summary

NCBI Gene PubMed Count 39
Grant Count 52
R01 Count 16
Funding $3,518,687.38
PubMed Score 94.37
PubTator Score 46.56

Knowledge Summary

Patent

No data available

Expression

Gene RIF (23)

PMID Text
25785833 knockdown of CDK2AP1 in primary human fibroblasts reduced proliferation and induced premature senescence, with the observed phenotype being p53 dependent
24889487 In summary, p12CDK2AP1 expression in myxofibrosarcoma cells induces G0/G1 arrest and mitochondria dependent proapoptotic activity and down-regulation of p12CDK2AP1 by shRNAi results in up-regulation of the CDK2 transcript and protein.
24620959 Study reports that knockdown of CDK2AP1 by RNAi in glioma cells could effectively inhibit cell proliferation by inducing cell cycle arrest and apoptosis
23404055 CDK2AP1 plays an important role in modulating the growth and tumorigenesis of lung cancer cells.
22791769 Low CDK2AP1 expression is common and associated with adverse prognosis in nasopharyngeal carcinoma.
22427660 Human cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) is dimeric in its disulfide-reduced state, with natively disordered N-terminal region
21865592 exerts its effect on stem cell maintenance/differentiation through epigenetic regulation [review]
21740085 In comparison with the healthy gingiva, the expression of Doc-1 was decreased, whereas the expression of S100A7 was upregulated in all oral lesions.
21328460 P12(CDK2AP1) is downregulated by miR-21
21187770 Missing down-regulation of the tumor-suppressor gene DOC-1, might exert protective effects and counteract malignant transformation of benign, proliferating lesions of the oral cavity.
More...

AA Sequence

MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAII      1 - 70
EELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS                              71 - 115
//

Text Mined References (40)

PMID Year Title
25785833 2015 Knockdown of CDK2AP1 in primary human fibroblasts induces p53 dependent senescence.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24889487 2014 Clinical aggressiveness of myxofibrosarcomas associates with down-regulation of p12CDK2AP1: prognostic implication of a putative tumor suppressor that induces cell cycle arrest and apoptosis via mitochondrial pathway.
24620959 2014 Knockdown of CDK2AP1 by RNA interference inhibits cell growth and tumorigenesis of human glioma.
24248101 2014 Interaction between p12CDK2AP1 and a novel unnamed protein product inhibits cell proliferation by regulating the cell cycle.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23404055 2013 Cyclin-dependent kinase 2-associated protein 1 suppresses growth and tumorigenesis of lung cancer.
22791769 2012 Expression of cyclin-dependent kinase 2-associated protein 1 confers an independent prognosticator in nasopharyngeal carcinoma: a cohort study.
More...