Property Summary

NCBI Gene PubMed Count 29
Grant Count 3
R01 Count 3
Funding $134,385.5
PubMed Score 39.58
PubTator Score 28.43

Knowledge Summary

Patent

No data available

Synonym

Accession O14512 A2VCU2 Q0IJ63 SOCS-7
Symbols NAP4
NCKAP4

Gene

Gene RIF (13)

PMID Text
25286386 This study showed that increased protein levels of SOCS-4 and SOCS-7 in Alzheimer's disease brains.
25162020 This SOCS7 knockdown-attributed effect could be due to a precise anti-PLCg-1 role.
24046004 Insulin Like Growth Factor I treatment and SOCS7 loss have synergistically resulted in increased growth and migration of MCF7 and in increased migration of MDA-MB-231 cells.
23767996 genetic variants in the SOCS7 gene do not impact variation in glucose homeostasis traits and only minimally impact risk of T2DM in the Old Order Amish
23392170 SOCS7 functioned as an oncogene, the finding that revealed a novel mechanism of carcinogenesis in bladder cancer cells.
22397880 The present report describes for the first time associations between common variants in SOCS7 gene and obesity, central obesity, insulin resistance and disorders of lipid metabolism in nondiabetic men from Argentina.
22213096 LNCaP-S17 cells are resistant to exogenous IL-6-induced neuroendocrine differentiation due to increased levels of CIS/SOCS7 that block activation of JAK2-STAT3 pathways.
20433750 Higher mRNA expression levels of SOCS1, 3, 4 and 7 are significantly associated with earlier tumour stage and better clinical outcome in human breast cancer.
20357037 findings show that PPAR-gamma is involved in the regulation of SOCS-7 expression by hepatitis C virus core protein genotype 3a
17803907 Demonstrate connection between septins/SOCS7/NCK signaling and the DNA damage response.
More...

AA Sequence

MVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAG      1 - 70
PGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGLESEAESLETNSCSEEELSSP     71 - 140
GRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLSRGEQQQQQQQQPPPPPPPPGPLRPLAGPSRKGSF    141 - 210
KIRLSRLFRTKSCNGGSGGGDGTGKRPSGELAASAASLTDMGGSAGRELDAGRKPKLTRTQSAFSPVSFS    211 - 280
PLFTGETVSLVDVDISQRGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPP    281 - 350
HAPDAFPRIAPIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDG    351 - 420
SFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYF    421 - 490
LRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEV    491 - 560
YLSLKEAQLISKQKQEVEPST                                                     561 - 581
//

Text Mined References (29)

PMID Year Title
25286386 2015 Expression of suppressor of cytokine signaling genes in human elderly and Alzheimer's disease brains and human microglia.
25162020 2014 In vitro and in vivo effects of suppressor of cytokine signalling 7 knockdown in breast cancer: the influence on cellular response to hepatocyte growth factor.
24046004 2014 Observations on the effects of Suppressor of Cytokine Signaling 7 (SOCS7) knockdown in breast cancer cells: their in vitro response to Insulin Like Growth Factor I (IGF-I).
23767996 2013 Polymorphisms in the SOCS7 gene and glucose homeostasis traits.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23392170 2013 socs7, a target gene of microRNA-145, regulates interferon-? induction through STAT3 nuclear translocation in bladder cancer cells.
22397880 2013 Common variants in SOCS7 gene predict obesity, disturbances in lipid metabolism and insulin resistance.
22213096 2012 LNCaP prostate cancer cells with autocrine interleukin-6 expression are resistant to IL-6-induced neuroendocrine differentiation due to increased expression of suppressors of cytokine signaling.
20598684 2010 Abi1/Hssh3bp1 pY213 links Abl kinase signaling to p85 regulatory subunit of PI-3 kinase in regulation of macropinocytosis in LNCaP cells.
20433750 2010 Higher expression levels of SOCS 1,3,4,7 are associated with earlier tumour stage and better clinical outcome in human breast cancer.
More...