Property Summary

NCBI Gene PubMed Count 15
Grant Count 30
R01 Count 18
Funding $1,133,031.98
PubMed Score 30.00
PubTator Score 24.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.245 0.000
ependymoma 1.200 0.002
group 3 medulloblastoma -1.300 0.016
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell -1.300 0.015
fibroadenoma 1.300 0.015
interstitial cystitis -2.200 0.000
non-inflammatory breast cancer -2.600 0.000
ovarian cancer 1.300 0.000

Gene RIF (8)

PMID Text
19086053 Observational study of gene-disease association. (HuGE Navigator)
17962208 NRG2 was positive in almost all breast cancers studied. High expression is related to the biological aggressiveness of breast cancer.
17945187 Gln43 of NRG2beta is both necessary and sufficient for NRG2 stimulation of ErbB4 coupling to IL3 independence.
17598910 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17563728 Observational study of gene-disease association. (HuGE Navigator)
17563728 Linkage interval for GLC1M was refined to a smaller region. The NRG2 gene was excluded as the causative gene for juvenile-onset primary open angle glaucoma.
15961242 Nrg-2-induced Acetylcholine Receptor transcription requires an N-box motif and is regulated by alternative splicing.
14722120 examination of the effect of isoforms on angiogenesis

AA Sequence

MRQVCCSALPPPPLEKGRCSSYSDSSSSSSERSSSSSSSSSESGSSSRSSSNNSSISRPAAPPEPRPQQQ      1 - 70
PQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQDQAYKAPVVVEGKVQGLVP     71 - 140
AGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTA    141 - 210
FAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRS    211 - 280
RDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAK    281 - 350
SYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTITGICVALLVVG    351 - 420
IVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPATDHVIRRETE    421 - 490
TTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDSQSGIMLSSVGTSKCNSPACVEARARRA    491 - 560
AAYNLEERRRATAPPYHDSVDSLRDSPHSERYVSALTTPARLSPVDFHYSLATQVPTFEITSPNSAHAVS    561 - 630
LPPAAPISYRLAEQQPLLRHPAPPGPGPGPGPGPGPGADMQRSYDSYYYPAAGPGPRRGTCALGGSLGSL    631 - 700
PASPFRIPEDDEYETTQECAPPPPPRPRARGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSG    701 - 770
GGSASASDDDADDADGALAAESTPFLGLRGAHDALRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRGPP    771 - 840
PRAKQDSAPL                                                                841 - 850
//

Text Mined References (16)

PMID Year Title
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
17962208 2008 ErbB/HER ligands in human breast cancer, and relationships with their receptors, the bio-pathological features and prognosis.
17945187 2007 Inter-conversion of neuregulin2 full and partial agonists for ErbB4.
17598910 2007 Interactions among genes in the ErbB-Neuregulin signalling network are associated with increased susceptibility to schizophrenia.
17563728 2007 Fine mapping of new glaucoma locus GLC1M and exclusion of neuregulin 2 as the causative gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15961242 2005 Stimulation of acetylcholine receptor transcription by neuregulin-2 requires an N-box response element and is regulated by alternative splicing.
14722120 2004 The N-terminal region of NTAK/neuregulin-2 isoforms has an inhibitory activity on angiogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10974560 2000 Characterization of the human NTAK gene structure and distribution of the isoforms for rat NTAK mRNA.
More...