Property Summary

NCBI Gene PubMed Count 16
PubMed Score 32.00
PubTator Score 24.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 2.6e-04
Breast cancer -1.200 1.6e-05
ependymoma 1.200 1.8e-03
fibroadenoma 1.300 1.5e-02
glioblastoma 1.200 4.1e-04
group 3 medulloblastoma -1.100 2.1e-02
interstitial cystitis -1.200 3.5e-03
medulloblastoma, large-cell -1.300 1.5e-02
osteosarcoma -1.245 8.8e-06
ovarian cancer 1.300 7.3e-06

Gene RIF (9)

AA Sequence

MRQVCCSALPPPPLEKGRCSSYSDSSSSSSERSSSSSSSSSESGSSSRSSSNNSSISRPAAPPEPRPQQQ      1 - 70
PQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQDQAYKAPVVVEGKVQGLVP     71 - 140
AGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTA    141 - 210
FAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRS    211 - 280
RDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAK    281 - 350
SYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTITGICVALLVVG    351 - 420
IVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPATDHVIRRETE    421 - 490
TTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDSQSGIMLSSVGTSKCNSPACVEARARRA    491 - 560
AAYNLEERRRATAPPYHDSVDSLRDSPHSERYVSALTTPARLSPVDFHYSLATQVPTFEITSPNSAHAVS    561 - 630
LPPAAPISYRLAEQQPLLRHPAPPGPGPGPGPGPGPGADMQRSYDSYYYPAAGPGPRRGTCALGGSLGSL    631 - 700
PASPFRIPEDDEYETTQECAPPPPPRPRARGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSG    701 - 770
GGSASASDDDADDADGALAAESTPFLGLRGAHDALRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRGPP    771 - 840
PRAKQDSAPL                                                                841 - 850
//

Text Mined References (17)

PMID Year Title