Property Summary

NCBI Gene PubMed Count 90
PubMed Score 804.72
PubTator Score 367.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma -1.495 3.7e-03
adult high grade glioma 2.200 9.3e-04
Astrocytoma, Pilocytic 1.800 1.2e-05
atypical teratoid / rhabdoid tumor 1.200 2.4e-02
Breast cancer -2.700 6.6e-08
breast carcinoma -1.100 2.3e-18
colon cancer -1.100 1.5e-02
cystic fibrosis 1.100 6.3e-03
ependymoma 2.600 2.7e-07
glioblastoma 1.800 1.5e-03
group 3 medulloblastoma 2.400 2.3e-04
intraductal papillary-mucinous adenoma (... -2.600 6.2e-05
intraductal papillary-mucinous carcinoma... -2.000 8.3e-04
intraductal papillary-mucinous neoplasm ... -3.200 1.2e-03
invasive ductal carcinoma -1.893 2.1e-03
lung adenocarcinoma -1.100 4.8e-07
lung cancer -4.300 6.3e-06
lung carcinoma -1.300 7.4e-09
malignant mesothelioma -2.800 2.3e-07
medulloblastoma, large-cell 3.200 2.1e-03
non-small cell lung cancer -2.100 5.6e-12
ovarian cancer -1.700 7.6e-08
pancreatic ductal adenocarcinoma liver m... -1.181 8.9e-03
primitive neuroectodermal tumor 1.600 5.6e-04
psoriasis -1.200 7.6e-06
tuberculosis 1.200 2.7e-04
ulcerative colitis -1.200 1.2e-03

 GO Component (2)

Protein-protein Interaction (1)

Gene RIF (62)

AA Sequence

MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTF      1 - 70
LIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGP     71 - 140
EAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV                141 - 198
//

Text Mined References (93)

PMID Year Title