Property Summary

NCBI Gene PubMed Count 83
Grant Count 73
R01 Count 53
Funding $8,490,537.56
PubMed Score 772.51
PubTator Score 367.41

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O14508 A8K3D1 O14542 O95102 Q9UKS5 SOCS-2
Symbols CIS2
SSI2
Cish2
SSI-2
SOCS-2
STATI2

Gene

PDB

4JGH   2C9W   5BO4  

Gene RIF (55)

PMID Text
27071013 SOCS2 may improve outcome of TBI in mice by regulating aspects of the neuroinflammatory response
26709655 focus on SOCS2 and review its biological function as well as its implication in pathological processes
26121586 crystals of SOCS2 in complex with its adaptor proteins, Elongin C and Elongin B, underwent a change in crystallographic parameters when treated with dimethyl sulfoxide during soaking experiments.
25561270 miR-101 functions as a growth-suppressive miRNA in H. pylori related GC, and that its suppressive effects are mediated mainly by repressing SOCS2 expression.
25286386 This study showed that there was significantly increased levels of SOCS-2 mRNA in elderly and Alzheimer's disease brains.
25283341 This study shows that over-expression of SOCS2 reduces the psychostimulant effects of amphetamine, enhances PPI, and alters mesolimbic dopaminergic activity.
25025962 Stage-independent downregulation of SOCS2 and SOCS6 correlate with disease-free survival in colorectal cancer.
24905066 The SOCS2 polymorphism (rs3782415) has an influence on the adult height of children with Turner syndrome and growth hormone deficiency after long-term therapy.
24559289 our study indicates that high SOCS2 expression is associated with poor survival in pediatric AML.
24280133 SOCS2 correlates with malignancy and exerts growth-promoting effects in prostate cancer.
More...

AA Sequence

MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTF      1 - 70
LIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGP     71 - 140
EAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV                141 - 198
//

Text Mined References (86)

PMID Year Title
27071013 2016 Suppressor of Cytokine Signaling-2 (SOCS2) Regulates the Microglial Response and Improves Functional Outcome after Traumatic Brain Injury in Mice.
26709655 2016 SOCS2: physiological and pathological functions.
26121586 2015 Serendipitous SAD Solution for DMSO-Soaked SOCS2-ElonginC-ElonginB Crystals Using Covalently Incorporated Dimethylarsenic: Insights into Substrate Receptor Conformational Flexibility in Cullin RING Ligases.
25561270 2015 MiR-101 inhibits cell growth and tumorigenesis of Helicobacter pylori related gastric cancer by repression of SOCS2.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25286386 2015 Expression of suppressor of cytokine signaling genes in human elderly and Alzheimer's disease brains and human microglia.
25283341 2015 Dopaminergic activity and behaviour in SOCS2 transgenic mice: Revealing a potential drug target for schizophrenia.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
25025962 2014 Identification of SOCS2 and SOCS6 as biomarkers in human colorectal cancer.
24905066 2014 Genetic predictors of long-term response to growth hormone (GH) therapy in children with GH deficiency and Turner syndrome: the influence of a SOCS2 polymorphism.
More...