Property Summary

NCBI Gene PubMed Count 72
PubMed Score 64.20
PubTator Score 41.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Myocardial Ischemia 169
glioblastoma 5572
Disease Target Count P-value
lung carcinoma 2844 5.65585765094009E-11
posterior fossa group A ependymoma 1511 1.0615448190177E-7
ovarian cancer 8492 7.20283020176893E-7
psoriasis 6685 9.61916982854566E-6
osteosarcoma 7933 1.38157959810539E-5
lung cancer 4473 3.41406301257341E-5
primitive neuroectodermal tumor 3031 3.45932321058946E-5
tuberculosis and treatment for 3 months 327 5.51132976358419E-5
group 3 medulloblastoma 2254 1.19982823504943E-4
urothelial carcinoma 318 2.91432395352359E-4
invasive ductal carcinoma 2950 7.37770841190053E-4
active ulcerative colitis 477 8.62217289361853E-4
pituitary cancer 1972 0.00192413462629718
COPD 116 0.00327248372919565
inflammatory breast cancer 404 0.00537930374257034
nephrosclerosis 329 0.00668829236992292
pancreatic cancer 2300 0.00701165685900549
medulloblastoma, large-cell 6234 0.00746910260220262
gastric carcinoma 832 0.00887730767310779
primary pancreatic ductal adenocarcinoma 1271 0.0126484986737372
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0163118051089786
astrocytoma 1493 0.0169185082406544
aldosterone-producing adenoma 664 0.0189090670807975
acute quadriplegic myopathy 1157 0.0190949265540919
X-linked cerebral adrenoleukodystrophy 115 0.0215025085815455
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0240257809258761
diabetes mellitus 1663 0.0303086282990518
acute myeloid leukemia 785 0.0462836922547862
Disease Target Count Z-score Confidence
Corneal disease 32 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.04 1.5

Expression

Synonym

Accession O14503 Q96TD3 bHLHe40
Symbols DEC1
HLHB2
BHLHB2
Clast5
SHARP2
STRA13
Stra14
SHARP-2

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (52)

PMID Text
26391953 BHLHE40/41 are promising markers to predict the aggressiveness of each Endometrial Neoplasm case and that molecular targeting strategies involving BHLHE40/41 and SP1 may effectively regulate Endometrial Neoplasm progression.
25876658 DEC1 has a pro-apoptotic effect on human esophageal cancer TE 10 cells of well-differentiated type.
25202122 USP17 binds and deubiquitylates DEC1, markedly extending its half-life. Subsequently, during checkpoint recovery, DEC1 proteolysis is reestablished through betaTrCP-dependent ubiquitylation.
24758579 The expression of DEC1 was associated with the incidence of oral squamous cell carcinoma (OSCC) and there was a negative correlation between the expression of DEC1 and the prognosis of OSCC.
24404147 DEC1 coordinates with HDAC8 to differentially regulate TAp73 and DeltaNp73 expression.
24397494 Study demonstrates that DEC1 is involved in osteogenesis.
24100543 The efficacy of inhibiting HIF-1alpha and DEC1 expression as a possible treatment for HCC should be assessed in clinical trials.
23578198 Sunitinib treatment performance could be attributable to TIS, depending on p53/Dec1 activation.
23445622 DEC1 level was positively correlated with HIF-1alpha and Ki67 expression in gastric cancer.
23426649 Studied DEC1 & claudin-1 in invasive breast ductal carcinomas;found DEC1 elevated in invasive breast ductal carcinoma. DEC1 knockdown led to the enhanced expression of claudin-1 at both the mRNA and protein levels in breast cancer cell lines.
More...

AA Sequence

MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINE      1 - 70
CIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQE     71 - 140
MFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAK    141 - 210
GSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQ    211 - 280
ESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPV    281 - 350
LYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD            351 - 412
//

Text Mined References (77)

PMID Year Title
26391953 2015 Regulation of the Mechanism of TWIST1 Transcription by BHLHE40 and BHLHE41 in Cancer Cells.
25876658 2015 Basic helix-loop-helix transcription factor DEC1 regulates the cisplatin-induced apoptotic pathway of human esophageal cancer cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25202122 2014 USP17- and SCF?TrCP--regulated degradation of DEC1 controls the DNA damage response.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24758579 2014 The correlation between the expression of differentiated embryo-chondrocyte expressed gene l and oral squamous cell carcinoma.
24404147 2014 DEC1 coordinates with HDAC8 to differentially regulate TAp73 and ?Np73 expression.
More...