Property Summary

NCBI Gene PubMed Count 76
PubMed Score 66.56
PubTator Score 41.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (29)

Disease log2 FC p
glioblastoma 1.200 7.0e-03
active ulcerative colitis 1.198 3.0e-03
acute myeloid leukemia 1.500 4.6e-02
acute quadriplegic myopathy 1.068 1.9e-02
aldosterone-producing adenoma -1.612 1.9e-02
astrocytoma 1.700 1.7e-02
autosomal dominant Emery-Dreifuss muscul... 1.179 2.4e-02
COPD -1.200 3.3e-03
diabetes mellitus -1.500 3.0e-02
ependymoma 1.700 6.6e-05
gastric carcinoma 2.200 8.9e-03
group 3 medulloblastoma -2.900 1.2e-04
inflammatory breast cancer -1.500 5.4e-03
intraductal papillary-mucinous neoplasm ... 1.500 4.0e-03
invasive ductal carcinoma 1.800 7.4e-04
lung cancer -1.600 4.8e-04
lung carcinoma -1.500 5.7e-11
medulloblastoma, large-cell -1.800 7.5e-03
nephrosclerosis -1.184 6.7e-03
osteosarcoma 2.575 1.4e-05
ovarian cancer 3.200 7.2e-07
pancreatic cancer 1.600 2.9e-06
pituitary cancer -1.500 1.9e-03
primary pancreatic ductal adenocarcinoma 2.512 1.5e-02
primitive neuroectodermal tumor -2.300 3.5e-05
psoriasis 1.300 3.9e-05
tuberculosis -1.500 8.5e-04
urothelial carcinoma -2.100 2.9e-04
X-linked cerebral adrenoleukodystrophy 2.000 2.2e-02

Gene RIF (55)

AA Sequence

MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINE      1 - 70
CIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQE     71 - 140
MFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAK    141 - 210
GSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQ    211 - 280
ESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPV    281 - 350
LYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD            351 - 412
//

Text Mined References (82)

PMID Year Title