Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.66
PubTator Score 3.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

 CSPA Cell Line (2)

AA Sequence

MQELHLLWWALLLGLAQACPEPCDCGEKYGFQIADCAYRDLESVPPGFPANVTTLSLSANRLPGLPEGAF      1 - 70
REVPLLQSLWLAHNEIRTVAAGALASLSHLKSLDLSHNLISDFAWSDLHNLSALQLLKMDSNELTFIPRD     71 - 140
AFRSLRALRSLQLNHNRLHTLAEGTFTPLTALSHLQINENPFDCTCGIVWLKTWALTTAVSIPEQDNIAC    141 - 210
TSPHVLKGTPLSRLPPLPCSAPSVQLSYQPSQDGAELRPGFVLALHCDVDGQPAPQLHWHIQIPSGIVEI    211 - 280
TSPNVGTDGRALPGTPVASSQPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEG    281 - 350
GEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPGQLPPGLLLLGQSLL    351 - 420
LFFFLTSF                                                                  421 - 428
//

Text Mined References (9)

PMID Year Title