Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.50
PubTator Score 3.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Duchenne muscular dystrophy 602 7.05744885187004E-7
pituitary cancer 1972 3.86174723462395E-6
adrenocortical carcinoma 1427 2.323932903243E-5
psoriasis 6685 1.94227732016397E-4
pancreatic cancer 2300 2.5178891867973E-4
primary pancreatic ductal adenocarcinoma 1271 4.43676844908214E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00106187908101807
ovarian cancer 8492 0.00204472590520318
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0057194870352433
invasive ductal carcinoma 2950 0.0067261032178721
sonic hedgehog group medulloblastoma 1482 0.00789455824007026
Atopic dermatitis 944 0.0175005226520589
pilocytic astrocytoma 3086 0.0382809612534509

Expression

Synonym

Accession O14498
Symbols Meflin
HsT17563

Gene

PANTHER Protein Class (1)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA Inparanoid
Cow OMA Inparanoid

AA Sequence

MQELHLLWWALLLGLAQACPEPCDCGEKYGFQIADCAYRDLESVPPGFPANVTTLSLSANRLPGLPEGAF      1 - 70
REVPLLQSLWLAHNEIRTVAAGALASLSHLKSLDLSHNLISDFAWSDLHNLSALQLLKMDSNELTFIPRD     71 - 140
AFRSLRALRSLQLNHNRLHTLAEGTFTPLTALSHLQINENPFDCTCGIVWLKTWALTTAVSIPEQDNIAC    141 - 210
TSPHVLKGTPLSRLPPLPCSAPSVQLSYQPSQDGAELRPGFVLALHCDVDGQPAPQLHWHIQIPSGIVEI    211 - 280
TSPNVGTDGRALPGTPVASSQPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEG    281 - 350
GEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPGQLPPGLLLLGQSLL    351 - 420
LFFFLTSF                                                                  421 - 428
//

Text Mined References (9)

PMID Year Title
26924503 2016 Identification of Meflin as a Potential Marker for Mesenchymal Stromal Cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10512678 1999 Human and mouse ISLR (immunoglobulin superfamily containing leucine-rich repeat) genes: genomic structure and tissue expression.
9325048 1997 Cloning of the cDNA for a new member of the immunoglobulin superfamily (ISLR) containing leucine-rich repeat (LRR).
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.