Property Summary

NCBI Gene PubMed Count 29
Grant Count 7
R01 Count 7
Funding $492,432
PubMed Score 26.35
PubTator Score 70.55

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
23936490 the first of the two transmembrane regions in human SAC1 (TM1) functions in Golgi localization
23426360 Phosphorylation of lipin 1 and charge on the phosphatidic acid head group control its phosphatidic acid phosphatase activity and membrane association
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18755152 These results suggest that LPP1a is important for the determination of plasma FTY720-P levels.
17169329 These results suggest that the expression of PAP2a is directly regulated by p73.
17005594 LPP1 and LPP3 are distributed in distinct lipid rafts that may provide unique microenvironments defining their non-redundant physiological functions.
16950767 Lipopolysaccharide-induced up-regulation of cyclooxygenase-2 depends on the activity of the Mg(+2)-dependent phosphatidic acid phosphohydrolase 1 (PAP-1)
14506139 lipid phosphate phosphatase-1 has a role in regulating accumulation of lysophosphatidic acid in ovarian cancer
12444089 This protein and phosphoprotein SET regulate androgen production by P450c17.
12426308 this enzyme regulates interleukin-4-mediated STAT6 signaling.

AA Sequence

MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIV      1 - 70
IILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSK     71 - 140
INCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVS    141 - 210
IYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPS    211 - 280
NHQP                                                                      281 - 284
//

Text Mined References (30)

PMID Year Title
23936490 2013 The first transmembrane domain of lipid phosphatase SAC1 promotes Golgi localization.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23426360 2013 Phosphorylation of lipin 1 and charge on the phosphatidic acid head group control its phosphatidic acid phosphatase activity and membrane association.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18755152 2008 A splicing isoform of LPP1, LPP1a, exhibits high phosphatase activity toward FTY720 phosphate.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17169329 2007 The expression of phosphatidic acid phosphatase 2a, which hydrolyzes lipids to generate diacylglycerol, is regulated by p73, a member of the p53 family.
17079146 2006 Roles of phosphatidate phosphatase enzymes in lipid metabolism.
More...