Property Summary

NCBI Gene PubMed Count 30
PubMed Score 28.03
PubTator Score 70.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIV      1 - 70
IILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSK     71 - 140
INCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVS    141 - 210
IYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPS    211 - 280
NHQP                                                                      281 - 284
//

Text Mined References (31)

PMID Year Title