Property Summary

NCBI Gene PubMed Count 121
Grant Count 48
R01 Count 28
Funding $5,486,013.77
PubMed Score 337.80
PubTator Score 247.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (102)

PMID Text
26616722 that claudin-4 can be helpful at least in making a reliable differential diagnosis of spiradenoma when overlapping morphologic features do not allow to further subclassification in the overwhelming variety of the adnexal tumors.
26319240 claudin 1 and claudin 4 are differentially involved in atopic dermatitis pathogenesis
26109060 This meta-analysis shows that over-expression of claudin-4 is associated with progress of gastric cancer and poor prognosis of gastric cancer patients.
26058359 Results suggested that claudin-4, which was regulated by methylation status, plays an important role in breast cancer growth and malignancy via the control of cell proliferation, migration and apoptosis.
26043767 Results showed overexpression of CLDN4 in endometrial cancer cells. Its intracellular presence coupled with the biphasic effects of E2 on its expression in the cytoskeleton suggest that it may be involved in cell signaling to and from tight junctions.
25964581 Our results indicate that CLDN4 expression is correlated with poor prognosis, and CLDN1 expression may be an indicator of recurrence of oral squamous cell carcinoma.
25871476 Overexpression of claudin-4 induced formation of vascular channels in breast cancer.
25778318 Increased claudin 4 expression was related to advanced stage and decreased survival in nasopharyngeal carcinoma.
25755790 increased claudin-3 and claudin-4 expression may play a postive role in the progression and metastasis of gastric cancer
25697377 Data suggest that changes in DNA methylation in trophoblasts regulate (1) cell mobility/placentation, (2) expression of claudin-4 (CLDN4) and 4-fucosyltransferase (FUT4), and (3) matrix metalloproteinase (MMP2 and MMP9) activity.
More...

AA Sequence

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSL      1 - 70
LALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTA     71 - 140
HNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV     141 - 209
//

Text Mined References (122)

PMID Year Title
26616722 2016 Distinctive immunostaining of claudin-4 in spiradenomas.
26319240 2015 Diverse regulation of claudin-1 and claudin-4 in atopic dermatitis.
26109060 2015 Prognostic and clinical significance of claudin-4 in gastric cancer: a meta-analysis.
26058359 2015 Claudin-4 controls the proliferation, apoptosis, migration and in vivo growth of MCF-7 breast cancer cells.
26043767 2015 Estrogen-dependent expression and subcellular localization of the tight junction protein claudin-4 in HEC-1A endometrial cancer cells.
25964581 2015 The prognostic role of claudins -1 and -4 in oral squamous cell carcinoma.
25871476 2015 Claudin-4 is required for vasculogenic mimicry formation in human breast cancer cells.
25778318 Expression patterns of claudins 1, 4, and 7 and their prognostic significance in nasopharyngeal carcinoma.
25755790 2015 The expression patterns of tight junction protein claudin-1, -3, and -4 in human gastric neoplasms and adjacent non-neoplastic tissues.
25697377 2015 Genome-wide DNA methylation identifies trophoblast invasion-related genes: Claudin-4 and Fucosyltransferase IV control mobility via altering matrix metalloproteinase activity.
More...