Property Summary

NCBI Gene PubMed Count 133
PubMed Score 369.49
PubTator Score 247.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ductal carcinoma in situ 1.100 4.7e-02
gastric carcinoma 2.900 1.8e-02
interstitial cystitis -1.900 7.5e-04
intraductal papillary-mucinous carcinoma... 2.200 8.6e-03
intraductal papillary-mucinous neoplasm ... 1.800 1.2e-03
invasive ductal carcinoma 1.600 2.0e-03
lung adenocarcinoma 1.461 9.9e-05
malignant mesothelioma 1.600 2.8e-07
osteosarcoma 1.824 5.4e-07
ovarian cancer 2.800 2.7e-11
pancreatic cancer 1.700 1.5e-07

Gene RIF (113)

AA Sequence

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSL      1 - 70
LALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTA     71 - 140
HNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV     141 - 209
//

Text Mined References (134)

PMID Year Title