Property Summary

NCBI Gene PubMed Count 38
PubMed Score 34.82
PubTator Score 23.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.211 9.9e-05
adult high grade glioma -1.900 3.9e-03
astrocytic glioma -1.100 1.6e-02
Astrocytoma, Pilocytic -1.800 4.5e-05
atypical teratoid / rhabdoid tumor -2.200 4.0e-04
Endometriosis -1.634 1.6e-02
ependymoma -1.700 1.7e-02
glioblastoma -1.800 4.1e-06
group 3 medulloblastoma -1.400 2.2e-02
lung carcinoma 2.100 1.1e-12
malignant mesothelioma -5.100 8.0e-10
medulloblastoma, large-cell -2.300 3.8e-04
oligodendroglioma -1.100 5.6e-10
ovarian cancer -1.300 3.9e-02
primitive neuroectodermal tumor -2.100 5.2e-04

Gene RIF (14)

AA Sequence

MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASSTF      1 - 70
PRRHYTSQQELKDECALVPRTLATKANRIPANLLDQFERQLPLSRDGYHTLQYKRTAVEHRSDSPGRIRH     71 - 140
LVHSVQKLFTKSHSLEGPSKGSVNGGKASPDEAQAARYGKRSKSKERRAEPKARPSTSPGWWSSDDNLDG    141 - 210
DMCIYHAPSGVMTMGRCPDRSASQYFLEAYNTISEQAVKASRSNNDVKCSTCANLPVSLDTPLLKKSAWS    211 - 280
STLTVSRAREVYQKASVNMDQAMVKSESCQQERSCQYLQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKA    281 - 350
MGDEDSGDSDTSPKPSPKVAARRESYLKATQPSLTELTTLKISNEHSPKLQIRSHSYLRAVSEVSINRSL    351 - 420
DSLDPAGLLTSPKFRSRNESYMRAMSTISQVSEMEVNGQFESVCESVFSELESQAVEALDLPMPGCFRMR    421 - 490
SHSYVRAIEKGCSQDDECVSLRSSSPPRTTTTVRTIQSSTVSSCITTYKKTPPPVPPRTTTKPFISITAQ    491 - 560
SSTESAQDAYMDGQGQRGDIISQSGLSNSTESLDSMKALTAAIEAANAQIHGPASQHMGNNTATVTTTTT    561 - 630
IATVTTEDRKKDHFKKNRCLSIGIQVDDAEEPDKTGENKAPSKFQSVGVQVEEEKCFRRFTRSNSVTTAV    631 - 700
QADLDFHDNLENSLESIEDNSCPGPMARQFSRDASTSTVSIQGSGNHYHACAADDDFDTDFDPSILPPPD    701 - 770
PWIDSITEDPLEAVQRSVCHRDGHWFLKLLQAERDRMEGWCQQMEREERENNLPEDILGKIRTAVGSAQL    771 - 840
LMAQKFYQFRELCEENLNPNAHPRPTSQDLAGFWDMLQLSIENISMKFDELHQLKANNWKQMDPLDKKER    841 - 910
RAPPPVPKKPAKGPAPLIRERSLESSQRQEARKRLMAAKRAASVRQNSATESAESIEIYIPEAQTRL       911 - 977
//

Text Mined References (40)

PMID Year Title