Property Summary

NCBI Gene PubMed Count 38
Grant Count 59
R01 Count 31
Funding $5,865,763.76
PubMed Score 31.76
PubTator Score 23.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -5.100 0.000
astrocytoma -1.700 0.000
posterior fossa group A ependymoma -4.900 0.000
glioblastoma -4.300 0.000
oligodendroglioma -1.600 0.000
medulloblastoma -2.500 0.002
atypical teratoid / rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -3.900 0.000
primitive neuroectodermal tumor -3.000 0.000
adrenocortical carcinoma -1.211 0.000
pediatric high grade glioma -3.000 0.001
pilocytic astrocytoma -1.800 0.001
Endometriosis -1.634 0.016
lung carcinoma 2.100 0.000
ovarian cancer -1.300 0.039

Synonym

Accession O14490 A8MWN8 B2RMU8 B7WPA1 B7Z2H2 B7Z2I2 B7Z9Y4 O14489 P78335 DAP-1
Symbols DAP1
GKAP
DAP-1
SAPAP1
DLGAP1A
DLGAP1B
DAP-1-BETA
DAP-1-ALPHA

Gene

Gene RIF (14)

PMID Text
26485182 This study revealed a significant variant (rs12455524) within the gene DLGAP1 for Recurrent major depression.
25950743 These results strongly suggested involvement of the DLGAP1 gene product in the development of HIV-related lipoatrophy in Thai HIV patients.
24938595 Dimerization of DLC2 was required for its interaction with GKAP, which, in turn, potentiated GKAP self-association.
24821223 This study showed that DLGAP1 association with obsessive-compulsive disorder.
24156266 Results show that the expression and distribution of NMDA receptors subunits GluN1, GluN2A and GluN2B - together with that of postsynaptic protein PSD-95 - are modified in Alzheimer's disease compared to normal aging
22940546 Study identified six genetic variants, (rs145691437, rs3786431, rs201567254, rs3745051 and rs11662259) and one rare missense mutation (c.1922A>G). SNP- and haplotype-based analyses showed no association of these SNPs with schizophrenia.
22889921 dlgap1 showed the highest association, of snps examined, with ocd.
21070662 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
21041448 The GKAP controls the forces operating on microtubules and play a fundamental role in centrosome positioning and cell polarity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASSTF      1 - 70
PRRHYTSQQELKDECALVPRTLATKANRIPANLLDQFERQLPLSRDGYHTLQYKRTAVEHRSDSPGRIRH     71 - 140
LVHSVQKLFTKSHSLEGPSKGSVNGGKASPDEAQAARYGKRSKSKERRAEPKARPSTSPGWWSSDDNLDG    141 - 210
DMCIYHAPSGVMTMGRCPDRSASQYFLEAYNTISEQAVKASRSNNDVKCSTCANLPVSLDTPLLKKSAWS    211 - 280
STLTVSRAREVYQKASVNMDQAMVKSESCQQERSCQYLQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKA    281 - 350
MGDEDSGDSDTSPKPSPKVAARRESYLKATQPSLTELTTLKISNEHSPKLQIRSHSYLRAVSEVSINRSL    351 - 420
DSLDPAGLLTSPKFRSRNESYMRAMSTISQVSEMEVNGQFESVCESVFSELESQAVEALDLPMPGCFRMR    421 - 490
SHSYVRAIEKGCSQDDECVSLRSSSPPRTTTTVRTIQSSTVSSCITTYKKTPPPVPPRTTTKPFISITAQ    491 - 560
SSTESAQDAYMDGQGQRGDIISQSGLSNSTESLDSMKALTAAIEAANAQIHGPASQHMGNNTATVTTTTT    561 - 630
IATVTTEDRKKDHFKKNRCLSIGIQVDDAEEPDKTGENKAPSKFQSVGVQVEEEKCFRRFTRSNSVTTAV    631 - 700
QADLDFHDNLENSLESIEDNSCPGPMARQFSRDASTSTVSIQGSGNHYHACAADDDFDTDFDPSILPPPD    701 - 770
PWIDSITEDPLEAVQRSVCHRDGHWFLKLLQAERDRMEGWCQQMEREERENNLPEDILGKIRTAVGSAQL    771 - 840
LMAQKFYQFRELCEENLNPNAHPRPTSQDLAGFWDMLQLSIENISMKFDELHQLKANNWKQMDPLDKKER    841 - 910
RAPPPVPKKPAKGPAPLIRERSLESSQRQEARKRLMAAKRAASVRQNSATESAESIEIYIPEAQTRL       911 - 977
//

Text Mined References (40)

PMID Year Title
26485182 2016 Recurrent major depression and right hippocampal volume: A bivariate linkage and association study.
25950743 2015 Genome-Wide Association Study of HIV-Related Lipoatrophy in Thai Patients: Association of a DLGAP1 Polymorphism with Fat Loss.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24938595 2014 The stoichiometry of scaffold complexes in living neurons - DLC2 functions as a dimerization engine for GKAP.
24821223 2015 Genome-wide association study in obsessive-compulsive disorder: results from the OCGAS.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24156266 2014 Pathological reorganization of NMDA receptors subunits and postsynaptic protein PSD-95 distribution in Alzheimer's disease.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
22940546 2013 Genetic analysis of the DLGAP1 gene as a candidate gene for schizophrenia.
More...