Property Summary

NCBI Gene PubMed Count 101
PubMed Score 1341.56
PubTator Score 276.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 9.62599077037941E-16
ovarian cancer 8492 9.33091584786175E-10
malignant mesothelioma 3163 2.05048157390723E-7
colon cancer 1475 4.76813751775872E-7
group 4 medulloblastoma 1875 1.03268536455206E-6
non-small cell lung cancer 2798 3.78419948551363E-6
acute quadriplegic myopathy 1157 4.84624723335166E-6
glioblastoma 5572 4.19220602181983E-5
interstitial cystitis 2299 1.00515398635902E-4
Pick disease 1893 1.00927290331881E-4
atypical teratoid / rhabdoid tumor 4369 1.70821268820713E-4
pancreatic cancer 2300 3.16447210715601E-4
medulloblastoma, large-cell 6234 5.13064459408649E-4
psoriasis 6685 7.74152021227512E-4
pediatric high grade glioma 2712 9.36244555745564E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00126219019062371
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00139712608557242
oligodendroglioma 2849 0.0015603903100062
non diabetic and post-ischemic heart failure 200 0.00163661841387854
pituitary cancer 1972 0.00252724684500094
Duchenne muscular dystrophy 602 0.00291447550855962
Down syndrome 548 0.00316288585619652
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00429639823151102
posterior fossa group A ependymoma 1511 0.00443498317841751
progressive supranuclear palsy 674 0.00535001459976917
active Crohn's disease 918 0.00614686600210261
Polycystic Ovary Syndrome 335 0.00644425044221663
limb girdle muscular dystrophy 2A 156 0.00660995526528296
ductal carcinoma in situ 1745 0.00785388335745668
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00813863236925326
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00859209753532114
astrocytic glioma 2241 0.00874794638440678
osteosarcoma 7933 0.00883211038429077
cystic fibrosis 1670 0.0115790235644399
non primary Sjogren syndrome sicca 840 0.0139887091785205
invasive ductal carcinoma 2950 0.0149078187490117
active ulcerative colitis 477 0.015938843071937
Hydrolethalus syndrome 128 0.0216777462460606
Breast cancer 3099 0.0250850779809415
COPD 116 0.0294913816682356
aldosterone-producing adenoma 664 0.0326226627306353
Alzheimer's disease 644 0.0462105221448539

Expression

  Differential Expression (42)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
astrocytic glioma 2.400 0.009
oligodendroglioma 3.200 0.002
psoriasis 1.900 0.001
osteosarcoma 2.634 0.009
group 4 medulloblastoma -2.700 0.000
cystic fibrosis 1.200 0.012
non diabetic and post-ischemic heart fai... -1.600 0.002
atypical teratoid / rhabdoid tumor 2.600 0.000
glioblastoma 2.300 0.000
medulloblastoma, large-cell 1.600 0.001
Duchenne muscular dystrophy 1.230 0.003
autosomal dominant Emery-Dreifuss muscul... 2.230 0.008
acute quadriplegic myopathy 2.457 0.000
limb girdle muscular dystrophy 2A 1.176 0.007
pancreatic ductal adenocarcinoma liver m... -1.342 0.009
non-small cell lung cancer 1.064 0.000
intraductal papillary-mucinous adenoma (... 2.200 0.004
intraductal papillary-mucinous carcinoma... 3.100 0.001
intraductal papillary-mucinous neoplasm ... 4.400 0.001
Hydrolethalus syndrome -1.954 0.022
colon cancer 3.100 0.000
active Crohn's disease 4.234 0.006
active ulcerative colitis 3.170 0.016
pancreatic cancer 1.700 0.000
Breast cancer 4.600 0.025
interstitial cystitis -1.500 0.000
pediatric high grade glioma 1.500 0.001
posterior fossa group A ependymoma 1.100 0.004
non primary Sjogren syndrome sicca 1.800 0.014
aldosterone-producing adenoma -1.627 0.033
invasive ductal carcinoma -2.400 0.015
COPD -1.200 0.029
Polycystic Ovary Syndrome -1.257 0.006
lung carcinoma -2.800 0.000
Alzheimer's disease -1.300 0.046
Pick disease -2.100 0.000
progressive supranuclear palsy -2.100 0.005
ductal carcinoma in situ -2.100 0.008
ovarian cancer 1.100 0.000
pituitary cancer 2.000 0.003
Down syndrome 1.100 0.003

Synonym

Accession O00767 B2R5U0 D3DR68 Q16150 Q53GR9 Q5W037 Q5W038 Q6GSS4 Q96KF6 Q9BS07 Q9Y695
Symbols SCD1
FADS5
SCDOS
hSCD1
MSTP008

Gene

SCD

PDB

4ZYO  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Platypus OMA Inparanoid

Gene RIF (85)

PMID Text
26469385 HIV-1 MA increases SCD mRNA expression in HepG2 cells
26391970 Chronic exposure to chewing tobacco induces carcinogenesis in non-malignant oral epithelial cells and SCD plays an essential role in this process.
26022099 This study illustrates for the first time that, in contrast to hepatic and adipose tissue, estrogen induces SCD-1 expression and activity in breast carcinoma cells. These results support SCD-1 as a therapeutic target in estrogen-sensitive breast cancer.
25880005 Both siRNA-mediated and pharmacological inhibition of SCD1 impaired tumor cells migration.
25528629 SCD1 negatively regulates autophagy-induced cell death in human hepatocellular carcinoma through inactivation of the AMPK signaling pathway.
25264165 The data indicate a direct inhibitory interaction of polyunsaturated fatty acids with LXRalpha, a consequent reduction of SREBP-1 and of its binding to SCD1 promoter.
25122791 These data further support the idea that SCD1 is associated with hepatitis C virus replication complex and that its products may contribute to the proper formation and maintenance of membranous web structures during virus replication.
24864084 Stearoyl-CoA desaturase is encoded by an SCD gene, which, depending on the species, may exist as different isoforms. (review)
24827925 DNA methylation levels of the SCD1 promoter were associated with weight change and with adherence to a Mediterranean diet.
24780075 An association with Graves ophthalmopathy was shown for SNP rs1393491 in SCD.
More...

AA Sequence

MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVE      1 - 70
YVWRNIILMSLLHLGALYGITLIPTCKFYTWLWGVFYYFVSALGITAGAHRLWSHRSYKARLPLRLFLII     71 - 140
ANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGSTLDLSDLEAEKL    141 - 210
VMFQRRYYKPGLLMMCFILPTLVPWYFWGETFQNSVFVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNI    211 - 280
SPRENILVSLGAVGEGFHNYHHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKR    281 - 350
TGDGNYKSG                                                                 351 - 359
//

Text Mined References (109)

PMID Year Title
26391970 2015 Chronic exposure to chewing tobacco selects for overexpression of stearoyl-CoA desaturase in normal oral keratinocytes.
26098317 2015 Crystal structure of human stearoyl-coenzyme A desaturase in complex with substrate.
26022099 2015 17?-estradiol induces stearoyl-CoA desaturase-1 expression in estrogen receptor-positive breast cancer cells.
25880005 2015 Stearoyl-CoA desaturase 1 and paracrine diffusible signals have a major role in the promotion of breast cancer cell migration induced by cancer-associated fibroblasts.
25528629 2015 SCD1 negatively regulates autophagy-induced cell death in human hepatocellular carcinoma through inactivation of the AMPK signaling pathway.
25264165 2014 Binding of polyunsaturated fatty acids to LXR? and modulation of SREBP-1 interaction with a specific SCD1 promoter element.
25122791 2014 Stearoyl coenzyme A desaturase 1 is associated with hepatitis C virus replication complex and regulates viral replication.
24864084 2014 [Stearoyl-CoA desaturase--the lipid metabolism regulator].
24827925 2014 Methylation levels of the SCD1 gene promoter and LINE-1 repeat region are associated with weight change: an intervention study.
24816252 2014 An atlas of genetic influences on human blood metabolites.
More...