Property Summary

Ligand Count 413
NCBI Gene PubMed Count 111
PubMed Score 1173.14
PubTator Score 276.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2843 9.6e-16
ovarian cancer 8519 9.3e-10
malignant mesothelioma 3232 9.3e-07
non-small cell lung cancer 2890 3.8e-06
acute quadriplegic myopathy 1158 4.8e-06
atypical teratoid / rhabdoid tumor 5112 8.2e-05
Pick disease 1894 9.0e-05
pituitary cancer 1972 1.7e-04
invasive ductal carcinoma 2950 1.8e-04
cystic fibrosis 1695 2.5e-04
glioblastoma 5792 2.9e-04
pancreatic cancer 2398 3.2e-04
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.3e-03
intraductal papillary-mucinous neoplasm (IPMN) 3290 1.4e-03
psoriasis 6694 1.6e-03
non diabetic and post-ischemic heart failure 200 1.6e-03
Duchenne muscular dystrophy 601 2.9e-03
Down syndrome 499 3.2e-03
medulloblastoma, large-cell 6241 3.3e-03
active Crohn's disease 922 3.5e-03
pediatric high grade glioma 1064 4.2e-03
intraductal papillary-mucinous adenoma (IPMA) 2954 4.3e-03
posterior fossa group A ependymoma 468 4.4e-03
progressive supranuclear palsy 676 5.3e-03
Hydrolethalus syndrome 128 6.2e-03
Polycystic ovary syndrome 360 6.4e-03
limb girdle muscular dystrophy 2A 213 6.6e-03
ductal carcinoma in situ 1744 7.9e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 510 8.1e-03
interstitial cystitis 2312 1.1e-02
colon cancer 1478 1.2e-02
astrocytic glioma 2597 1.5e-02
osteosarcoma 7950 1.5e-02
active ulcerative colitis 764 1.6e-02
COPD 118 2.1e-02
non primary Sjogren syndrome sicca 891 2.3e-02
Breast cancer 3577 2.5e-02
aldosterone-producing adenoma 665 2.6e-02
Alzheimer's disease 658 2.8e-02
oligodendroglioma 2850 3.2e-02
pancreatic ductal adenocarcinoma liver metastasis 1962 3.9e-02
group 3 medulloblastoma 4104 4.5e-02

Expression

  Differential Expression (42)

Disease log2 FC p
active Crohn's disease 1.243 3.5e-03
active ulcerative colitis 3.170 1.6e-02
acute quadriplegic myopathy 2.457 4.8e-06
aldosterone-producing adenoma -1.193 2.6e-02
Alzheimer's disease -1.200 2.8e-02
astrocytic glioma 2.100 1.5e-02
atypical teratoid / rhabdoid tumor 2.100 8.2e-05
autosomal dominant Emery-Dreifuss muscul... 2.230 8.1e-03
Breast cancer 4.600 2.5e-02
colon cancer 1.900 1.2e-02
COPD -1.100 2.1e-02
cystic fibrosis -1.028 2.5e-04
Down syndrome 1.100 3.2e-03
Duchenne muscular dystrophy 1.230 2.9e-03
ductal carcinoma in situ -2.100 7.9e-03
glioblastoma 1.600 2.9e-04
group 3 medulloblastoma -1.300 4.5e-02
Hydrolethalus syndrome -1.811 6.2e-03
interstitial cystitis -1.100 1.1e-02
intraductal papillary-mucinous adenoma (... 2.200 4.3e-03
intraductal papillary-mucinous carcinoma... 3.100 1.3e-03
intraductal papillary-mucinous neoplasm ... 4.400 1.4e-03
invasive ductal carcinoma 1.641 1.8e-04
limb girdle muscular dystrophy 2A 1.176 6.6e-03
lung carcinoma -2.800 9.6e-16
malignant mesothelioma 1.300 9.3e-07
medulloblastoma, large-cell 1.100 3.3e-03
non diabetic and post-ischemic heart fai... -1.600 1.6e-03
non primary Sjogren syndrome sicca 1.100 2.3e-02
non-small cell lung cancer 1.064 3.8e-06
oligodendroglioma 1.300 3.2e-02
osteosarcoma 2.512 1.5e-02
ovarian cancer 1.100 9.3e-10
pancreatic cancer 1.700 3.2e-04
pancreatic ductal adenocarcinoma liver m... -1.043 3.9e-02
pediatric high grade glioma 1.400 4.2e-03
Pick disease -1.200 9.0e-05
pituitary cancer 1.200 1.7e-04
Polycystic ovary syndrome -1.257 6.4e-03
posterior fossa group A ependymoma 1.100 4.4e-03
progressive supranuclear palsy -1.700 5.3e-03
psoriasis 1.200 1.6e-03

Protein-protein Interaction (2)

Gene RIF (95)

AA Sequence

MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVE      1 - 70
YVWRNIILMSLLHLGALYGITLIPTCKFYTWLWGVFYYFVSALGITAGAHRLWSHRSYKARLPLRLFLII     71 - 140
ANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGSTLDLSDLEAEKL    141 - 210
VMFQRRYYKPGLLMMCFILPTLVPWYFWGETFQNSVFVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNI    211 - 280
SPRENILVSLGAVGEGFHNYHHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKR    281 - 350
TGDGNYKSG                                                                 351 - 359
//

Text Mined References (119)

PMID Year Title