Property Summary

NCBI Gene PubMed Count 101
Grant Count 348
R01 Count 124
Funding $67,242,076.2
PubMed Score 1341.56
PubTator Score 276.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (56)

Disease Z-score Confidence
Obesity 616 5.644 2.8
Fatty liver disease 84 4.949 2.5
Metabolic syndrome X 155 4.476 2.2
diabetes mellitus 1,663 4.238 2.1
Lipid metabolism disorder 102 4.006 2.0
Atherosclerosis 275 3.262 1.6
Cancer 2,346 3.225 1.6
Hyperglycemia 120 3.16 1.6
Alzheimer's disease 644
Animal Mammary Neoplasms 136
Breast cancer 3,094
COPD 113
Down syndrome 548
Duchenne muscular dystrophy 602
Hydrolethalus syndrome 128
Lipoidosis 19
Liver carcinoma 217
Liver neoplasms 109
Mammary Neoplasms, Experimental 150
Pick disease 1,893
Polycystic Ovary Syndrome 332
Thyroid associated opthalmopathies 2
active Crohn's disease 918
active ulcerative colitis 477
acute quadriplegic myopathy 1,157
aldosterone-producing adenoma 664
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
colon cancer 1,475
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
glioblastoma 5,572
group 4 medulloblastoma 1,875
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
limb girdle muscular dystrophy 2A 156
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
non diabetic and post-ischemic heart fai... 200 
non primary Sjogren syndrome sicca 840
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
progressive supranuclear palsy 674
psoriasis 6,685

Expression

  Differential Expression (42)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
astrocytic glioma 2.400 0.009
oligodendroglioma 3.200 0.002
psoriasis 1.900 0.001
osteosarcoma 2.634 0.009
group 4 medulloblastoma -2.700 0.000
cystic fibrosis 1.200 0.012
non diabetic and post-ischemic heart fai... -1.600 0.002
atypical teratoid / rhabdoid tumor 2.600 0.000
glioblastoma 2.300 0.000
medulloblastoma, large-cell 1.600 0.001
Duchenne muscular dystrophy 1.230 0.003
autosomal dominant Emery-Dreifuss muscul... 2.230 0.008
acute quadriplegic myopathy 2.457 0.000
limb girdle muscular dystrophy 2A 1.176 0.007
pancreatic ductal adenocarcinoma liver m... -1.342 0.009
non-small cell lung cancer 1.064 0.000
intraductal papillary-mucinous adenoma (... 2.200 0.004
intraductal papillary-mucinous carcinoma... 3.100 0.001
intraductal papillary-mucinous neoplasm ... 4.400 0.001
Hydrolethalus syndrome -1.954 0.022
colon cancer 3.100 0.000
active Crohn's disease 4.234 0.006
active ulcerative colitis 3.170 0.016
pancreatic cancer 1.700 0.000
Breast cancer 4.600 0.025
interstitial cystitis -1.500 0.000
pediatric high grade glioma 1.500 0.001
posterior fossa group A ependymoma 1.100 0.004
non primary Sjogren syndrome sicca 1.800 0.014
aldosterone-producing adenoma -1.627 0.033
invasive ductal carcinoma -2.400 0.015
COPD -1.200 0.029
Polycystic Ovary Syndrome -1.257 0.006
lung carcinoma -2.800 0.000
Alzheimer's disease -1.300 0.046
Pick disease -2.100 0.000
progressive supranuclear palsy -2.100 0.005
ductal carcinoma in situ -2.100 0.008
ovarian cancer 1.100 0.000
pituitary cancer 2.000 0.003
Down syndrome 1.100 0.003

Synonym

Accession O00767 B2R5U0 D3DR68 Q16150 Q53GR9 Q5W037 Q5W038 Q6GSS4 Q96KF6 Q9BS07 Q9Y695
Symbols SCD1
FADS5
SCDOS
hSCD1
MSTP008

Gene

SCD

PDB

4ZYO  

Gene RIF (85)

PMID Text
26469385 HIV-1 MA increases SCD mRNA expression in HepG2 cells
26391970 Chronic exposure to chewing tobacco induces carcinogenesis in non-malignant oral epithelial cells and SCD plays an essential role in this process.
26022099 This study illustrates for the first time that, in contrast to hepatic and adipose tissue, estrogen induces SCD-1 expression and activity in breast carcinoma cells. These results support SCD-1 as a therapeutic target in estrogen-sensitive breast cancer.
25880005 Both siRNA-mediated and pharmacological inhibition of SCD1 impaired tumor cells migration.
25528629 SCD1 negatively regulates autophagy-induced cell death in human hepatocellular carcinoma through inactivation of the AMPK signaling pathway.
25264165 The data indicate a direct inhibitory interaction of polyunsaturated fatty acids with LXRalpha, a consequent reduction of SREBP-1 and of its binding to SCD1 promoter.
25122791 These data further support the idea that SCD1 is associated with hepatitis C virus replication complex and that its products may contribute to the proper formation and maintenance of membranous web structures during virus replication.
24864084 Stearoyl-CoA desaturase is encoded by an SCD gene, which, depending on the species, may exist as different isoforms. (review)
24827925 DNA methylation levels of the SCD1 promoter were associated with weight change and with adherence to a Mediterranean diet.
24780075 An association with Graves ophthalmopathy was shown for SNP rs1393491 in SCD.
More...

AA Sequence

MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVE      1 - 70
YVWRNIILMSLLHLGALYGITLIPTCKFYTWLWGVFYYFVSALGITAGAHRLWSHRSYKARLPLRLFLII     71 - 140
ANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGSTLDLSDLEAEKL    141 - 210
VMFQRRYYKPGLLMMCFILPTLVPWYFWGETFQNSVFVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNI    211 - 280
SPRENILVSLGAVGEGFHNYHHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKR    281 - 350
TGDGNYKSG                                                                 351 - 359
//

Text Mined References (109)

PMID Year Title
26391970 2015 Chronic exposure to chewing tobacco selects for overexpression of stearoyl-CoA desaturase in normal oral keratinocytes.
26098317 2015 Crystal structure of human stearoyl-coenzyme A desaturase in complex with substrate.
26022099 2015 17?-estradiol induces stearoyl-CoA desaturase-1 expression in estrogen receptor-positive breast cancer cells.
25880005 2015 Stearoyl-CoA desaturase 1 and paracrine diffusible signals have a major role in the promotion of breast cancer cell migration induced by cancer-associated fibroblasts.
25528629 2015 SCD1 negatively regulates autophagy-induced cell death in human hepatocellular carcinoma through inactivation of the AMPK signaling pathway.
25264165 2014 Binding of polyunsaturated fatty acids to LXR? and modulation of SREBP-1 interaction with a specific SCD1 promoter element.
25122791 2014 Stearoyl coenzyme A desaturase 1 is associated with hepatitis C virus replication complex and regulates viral replication.
24864084 2014 [Stearoyl-CoA desaturase--the lipid metabolism regulator].
24827925 2014 Methylation levels of the SCD1 gene promoter and LINE-1 repeat region are associated with weight change: an intervention study.
24816252 2014 An atlas of genetic influences on human blood metabolites.
More...