Property Summary

NCBI Gene PubMed Count 33
PubMed Score 287.09
PubTator Score 41.00

Knowledge Summary

Patent (18,793)

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.200 9.9e-05
astrocytic glioma -1.200 3.5e-02
atypical teratoid / rhabdoid tumor -1.500 6.9e-06
Breast cancer 2.200 5.0e-02
breast carcinoma -1.100 5.4e-04
colon cancer 1.500 7.6e-04
cutaneous lupus erythematosus 1.400 2.7e-03
glioblastoma -1.400 4.9e-02
group 4 medulloblastoma -1.400 6.9e-05
intraductal papillary-mucinous adenoma (... 1.100 3.4e-03
invasive ductal carcinoma -2.300 1.9e-03
lung adenocarcinoma -1.200 3.3e-08
lung cancer -1.600 8.6e-04
medulloblastoma, large-cell -1.800 3.4e-05
Multiple myeloma 1.361 8.6e-03
non-small cell lung cancer -1.234 4.2e-13
osteosarcoma -1.419 4.0e-04
ovarian cancer -1.400 2.5e-04
primitive neuroectodermal tumor -1.400 5.4e-05
psoriasis 2.100 6.7e-05

 MGI Phenotype (1)

Gene RIF (10)

AA Sequence

MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLR      1 - 70
LNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKV     71 - 140
VPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNP    141 - 210
AGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGE    211 - 280
GVRPSPMQLELRMVQSKRDIEDPEIVVQATVL                                          281 - 312
//

Text Mined References (38)

PMID Year Title