Property Summary

NCBI Gene PubMed Count 50
Grant Count 60
R01 Count 39
Funding $8,516,894.21
PubMed Score 166.49
PubTator Score 86.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -2.400 0.000
psoriasis -2.000 0.000
osteosarcoma -4.789 0.000
group 4 medulloblastoma -1.700 0.000
medulloblastoma, large-cell -2.000 0.000
pancreatic ductal adenocarcinoma liver m... -1.775 0.016
non-small cell lung cancer -2.152 0.000
colon cancer -2.000 0.000
lung cancer -4.900 0.000
pancreatic cancer -1.300 0.001
Breast cancer -2.900 0.024
pediatric high grade glioma -1.100 0.002
pilocytic astrocytoma -1.200 0.001
primary Sjogren syndrome -1.500 0.022
lung adenocarcinoma -1.550 0.000
breast carcinoma -2.100 0.000
ductal carcinoma in situ -3.900 0.000
invasive ductal carcinoma -5.000 0.000
ovarian cancer -2.500 0.000
dermatomyositis 1.100 0.007

Synonym

Accession O00763 A6NK36 Q16852 Q1HEC1 Q6KE87 Q6KE89 Q6TY48
Symbols ACC2
ACCB
HACC275

Gene

PANTHER Protein Class (1)

PDB

2DN8   2HJW   2KCC   3FF6   3GID   3GLK   3JRW   3JRX   3TDC   4HQ6   5KKN  

Gene RIF (45)

PMID Text
26362536 HIV-1 Gag interacts with ACACB as demonstrated by proximity dependent biotinylation proteomics
26030797 A significant association exists of ACACB gene polymorphism and diabetic nephropathy among Caucasian patients with diabetes.
26022126 The knockdown of ACC2 reduced palmitic acid -induced autophagy and thus protects the cells from palmitic acid - induced lipotoxicity with attenuated lipid accumulation and rescued cell viability.
25262148 Our meta-analysis supports that the apolipoprotein E epsilon2 allele and acetyl-CoA carboxylase beta rs2268388 C>T might act as promotion factors of nephropathy in type 2 diabetes.
23460794 These data support a role for ACACB in obesity and potential roles for altered lipid metabolism in susceptibility to diabetic nephropathy.
23156397 Its involvement in the development of diabetic nephropathy is explained by the promotion of the so-called micro-inflammation associated with the diabetic state.
23081748 TT genotypes of ACACB gene (rs2268388) and CC genotype of AGTR1 gene (rs5186) confers the risk of diabetic nephropathy in Asian Indian patients with T2DM.
21953464 Structure-guided inhibitor design for human acetyl-coenzyme A carboxylase by interspecies active site conversion.
21908218 In conclusion, common polymorphisms of ACACB gene are associated with obesity and, independently, with type 2 diabetes in postmenopausal women
21887335 Common variants within the ACACB locus appear to regulate adipose gene expression
More...

AA Sequence

MVLLLCLSCLIFSCLTFSWLKIWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKT      1 - 70
PSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQ     71 - 140
GQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSSDEDSVAGSSRESTRKGSRASLGALSLEAYLTTGEA    141 - 210
ETRVPTMRPSMSGLHLVKRGREHKKLDLHRDFTVASPAEFVTRFGGDRVIEKVLIANNGIAAVKCMRSIR    211 - 280
RWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAG    281 - 350
WGHASENPKLPELLCKNGVAFLGPPSEAMWALGDKIASTVVAQTLQVPTLPWSGSGLTVEWTEDDLQQGK    351 - 420
RISVPEDVYDKGCVKDVDEGLEAAERIGFPLMIKASEGGGGKGIRKAESAEDFPILFRQVQSEIPGSPIF    421 - 490
LMKLAQHARHLEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAPLAIFEFMEQCAIRLAKTVGY    491 - 560
VSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGVPLHRLKDIRLLYGESPWGV    561 - 630
TPISFETPSNPPLARGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAATGGLHEFADSQF    631 - 700
GHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLINLLETESFQNNDIDTGWLDYLIAEKVQAEKPD    701 - 770
IMLGVVCGALNVADAMFRTCMTDFLHSLERGQVLPADSLLNLVDVELIYGGVKYILKVARQSLTMFVLIM    771 - 840
NGCHIEIDAHRLNDGGLLLSYNGNSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSPSAGKLTQYTV    841 - 910
EDGGHVEAGSSYAEMEVMKMIMTLNVQERGRVKYIKRPGAVLEAGCVVARLELDDPSKVHPAEPFTGELP    911 - 980
AQQTLPILGEKLHQVFHSVLENLTNVMSGFCLPEPVFSIKLKEWVQKLMMTLRHPSLPLLELQEIMTSVA    981 - 1050
GRIPAPVEKSVRRVMAQYASNITSVLCQFPSQQIATILDCHAATLQRKADREVFFINTQSIVQLVQRYRS   1051 - 1120
GIRGYMKTVVLDLLRRYLRVEHHFQQAHYDKCVINLREQFKPDMSQVLDCIFSHAQVAKKNQLVIMLIDE   1121 - 1190
LCGPDPSLSDELISILNELTQLSKSEHCKVALRARQILIASHLPSYELRHNQVESIFLSAIDMYGHQFCP   1191 - 1260
ENLKKLILSETTIFDVLPTFFYHANKVVCMASLEVYVRRGYIAYELNSLQHRQLPDGTCVVEFQFMLPSS   1261 - 1330
HPNRMTVPISITNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEDFTRNFDEVISCFANVPKDTPLFS   1331 - 1400
EARTSLYSEDDCKSLREEPIHILNVSIQCADHLEDEALVPILRTFVQSKKNILVDYGLRRITFLIAQEKE   1401 - 1470
FPKFFTFRARDEFAEDRIYRHLEPALAFQLELNRMRNFDLTAVPCANHKMHLYLGAAKVKEGVEVTDHRF   1471 - 1540
FIRAIIRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPFKIEES   1541 - 1610
VRYMVMRYGSRLWKLRVLQAEVKINIRQTTTGSAVPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSF   1611 - 1680
GNKQGPQHGMLINTPYVTKDLLQAKRFQAQTLGTTYIYDFPEMFRQALFKLWGSPDKYPKDILTYTELVL   1681 - 1750
DSQGQLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIGSFGPGEDLLYLRASEMARAE   1751 - 1820
GIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFKYLYLTPQDYTRISSLNSVHCKHIEEGGESR   1821 - 1890
YMITDIIGKDDGLGVENLRGSGMIAGESSLAYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILT   1891 - 1960
GASALNKVLGREVYTSNNQLGGVQIMHYNGVSHITVPDDFEGVYTILEWLSYMPKDNHSPVPIITPTDPI   1961 - 2030
DREIEFLPSRAPYDPRWMLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVE   2031 - 2100
TRTVEVAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQAVKDFNREKLPLMIFANWRGFSGGMKDMYDQ   2101 - 2170
VLKFGAYIVDGLRQYKQPILIYIPPYAELRGGSWVVIDATINPLCIEMYADKESRGGVLEPEGTVEIKFR   2171 - 2240
KKDLIKSMRRIDPAYKKLMEQLGEPDLSDKDRKDLEGRLKAREDLLLPIYHQVAVQFADFHDTPGRMLEK   2241 - 2310
GVISDILEWKTARTFLYWRLRRLLLEDQVKQEILQASGELSHVHIQSMLRRWFVETEGAVKAYLWDNNQV   2311 - 2380
VVQWLEQHWQAGDGPRSTIRENITYLKHDSVLKTIRGLVEENPEVAVDCVIYLSQHISPAERAQVVHLLS   2381 - 2450
TMDSPAST                                                                 2451 - 2458
//

Text Mined References (56)

PMID Year Title
26030797 2015 The ACACB gene rs2268388 polymorphism is associated with nephropathy in Caucasian patients with diabetes: a meta-analysis.
26022126 2015 Acetyl-CoA carboxylase 2 suppression rescues human proximal tubular cells from palmitic acid induced lipotoxicity via autophagy.
25262148 2015 The association between lipid metabolism gene polymorphisms and nephropathy in type 2 diabetes: a meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23460794 2013 An ACACB variant implicated in diabetic nephropathy associates with body mass index and gene expression in obese subjects.
23156397 2012 [Genetic study for diabetic microvascular complications--recent advances and future perspectives].
23081748 2013 ACAC? gene (rs2268388) and AGTR1 gene (rs5186) polymorphism and the risk of nephropathy in Asian Indian patients with type 2 diabetes.
21953464 2011 Structure-guided inhibitor design for human acetyl-coenzyme A carboxylase by interspecies active site conversion.
21908218 2011 Association of ACACB polymorphisms with obesity and diabetes.
21887335 2011 The effect of ACACB cis-variants on gene expression and metabolic traits.
More...