Property Summary

NCBI Gene PubMed Count 73
Grant Count 19
R01 Count 15
Funding $3,051,463.88
PubMed Score 85.93
PubTator Score 96.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (49)

PMID Text
26062455 the present study showed that miR-196a promoted cell proliferation by targeting UBE2C in breast cancer. Thus, miR-196a may be a potential oncogene in breast cancer and a promising therapeutic target in breast cancer treatment.
25917796 Study shows an overexpression of UbcH10 mRNA and protein in the vast majority of colorectal cancer (CRC) patients analyzed and indicates that UbcH10 expression regulates CRC growth.
25832867 UBE2C could regulate phospho-ERK1/2 level.
25825779 in addition to binding APC11's RING, UBCH10 is corecruited via interactions with APC2
25760688 Upregulation of miR-17/20a promotes gastric cancer cell growth by targeting UBE2C.
25739083 Data suggest that ubiquitin-conjugating enzyme UbcH10 may be a promising target for the therapy of breast cancer.
25376843 UbcH10 overexpression increases carcinogenesis and blocks ALLN susceptibility in colorectal cancer.
25368385 excess E2F1 due to Rb inactivation recruits the complex of Cdc20 and the anaphase-promoting complex/cyclosome to deregulate the expression of UBCH10
24815438 the UBE2C gene is capable of promoting proliferation and invasion of lung cancer cells. Therefore, UBE2C may play a pivotal role in development and invasion of lung cancer.
24699941 UBE2C may be a marker for diagnosis of nonpalpable breast lesions but not benign or malignant tumors in mammography core biopsies. Suppression of UBE2C may be a potential therapy target in breast cancer.
More...

AA Sequence

MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAA      1 - 70
GTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLG     71 - 140
EPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP                                   141 - 179
//

Text Mined References (80)

PMID Year Title
26062455 2015 MicroRNA-196a post-transcriptionally upregulates the UBE2C proto-oncogene and promotes cell proliferation in breast cancer.
25917796 2016 UbcH10 expression can predict prognosis and sensitivity to the antineoplastic treatment for colorectal cancer patients.
25832867 2015 Ubiquitin-conjugating enzyme E2C regulates apoptosis-dependent tumor progression of non-small cell lung cancer via ERK pathway.
25825779 2015 RING E3 mechanism for ubiquitin ligation to a disordered substrate visualized for human anaphase-promoting complex.
25760688 2015 Inhibition of microRNA-17/20a suppresses cell proliferation in gastric cancer by modulating UBE2C expression.
25739083 2015 Knockdown of UbcH10 enhances the chemosensitivity of dual drug resistant breast cancer cells to epirubicin and docetaxel.
25376843 2014 UbcH10 overexpression increases carcinogenesis and blocks ALLN susceptibility in colorectal cancer.
25368385 2015 Deregulation of Rb-E2F1 axis causes chromosomal instability by engaging the transactivation function of Cdc20-anaphase-promoting complex/cyclosome.
24815438 2014 Effects of ubiquitin-conjugating enzyme 2C on invasion, proliferation and cell cycling of lung cancer cells.
24699941 2014 Ubiquitin-conjugating enzyme UBE2C is highly expressed in breast microcalcification lesions.
More...