Property Summary

NCBI Gene PubMed Count 81
PubMed Score 92.13
PubTator Score 96.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma 2.892 2.6e-06
adult high grade glioma 2.200 2.2e-05
Atopic dermatitis 1.800 6.3e-05
atypical teratoid / rhabdoid tumor 3.500 1.4e-13
Breast cancer 2.000 4.7e-02
breast carcinoma 3.100 1.2e-07
ductal carcinoma in situ 2.300 2.2e-03
Endometriosis 1.599 6.7e-03
ependymoma 1.600 1.5e-06
esophageal adenocarcinoma 1.100 4.0e-02
glioblastoma 3.000 3.1e-10
group 3 medulloblastoma 4.100 5.6e-09
intraductal papillary-mucinous carcinoma... 1.700 3.7e-04
intraductal papillary-mucinous neoplasm ... 2.400 1.1e-04
invasive ductal carcinoma 3.000 3.6e-05
lung adenocarcinoma 2.900 4.0e-11
lung cancer 3.200 3.5e-05
malignant mesothelioma 1.800 2.0e-07
medulloblastoma, large-cell 4.300 1.6e-07
non-small cell lung cancer 3.677 2.5e-35
ovarian cancer 1.900 1.1e-05
pancreatic cancer 1.200 2.9e-05
primitive neuroectodermal tumor 3.600 4.9e-06
psoriasis 1.400 1.8e-47

Gene RIF (56)

AA Sequence

MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAA      1 - 70
GTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLG     71 - 140
EPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP                                   141 - 179
//

Text Mined References (89)

PMID Year Title