Property Summary

NCBI Gene PubMed Count 15
PubMed Score 108.97
PubTator Score 47.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

Synonym

Accession O00757 Q17R39 Q6FI53 FBPase 2
Symbols

Gene

PDB

3IFA   3IFC   4HE0   4HE1   4HE2   5ET5   5ET6   5ET7  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
24412565 Results demonstrate that truncation of the evolutionarily conserved N-terminal residues of FBP2 results in a loss of its mitochondria-protective functions.
24063558 FBP2 does negatively regulate cell growth, and reduced expression of FBP2 may contribute to carcinogenesis for gastric cancer.
20800603 Observational study of gene-disease association. (HuGE Navigator)
18214967 The existence of highly AMP-sensitive muscle-like FBPase, activity of which is regulated by metabolite-dependent interaction with aldolase enables the precise regulation of muscle energy expenditures.
16213487 The key role in strong AMP binding to muscle isozyme play K20, T177 and Q179.
9282826 HIV-1 Matrix activates fructose 1,6-bisphosphatase gene expression by induction of a 1alpha-hydroxylase activity

AA Sequence

MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDE      1 - 70
VKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIY     71 - 140
RKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIY    141 - 210
SLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLY    211 - 280
ECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS               281 - 339
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24412565 2014 Changes in quaternary structure of muscle fructose-1,6-bisphosphatase regulate affinity of the enzyme to mitochondria.
24086250 2013 Crystal structures of human muscle fructose-1,6-bisphosphatase: novel quaternary states, enhanced AMP affinity, and allosteric signal transmission pathway.
24063558 2013 Decreased fructose-1,6-bisphosphatase-2 expression promotes glycolysis and growth in gastric cancer cells.
22120740 2011 Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19626708 2009 Muscle FBPase is targeted to nucleus by its 203KKKGK207 sequence.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18214967 2008 Evolutionary conserved N-terminal region of human muscle fructose 1,6-bisphosphatase regulates its activity and the interaction with aldolase.
More...