Property Summary

NCBI Gene PubMed Count 16
PubMed Score 110.12
PubTator Score 47.99

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDE      1 - 70
VKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIY     71 - 140
RKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIY    141 - 210
SLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLY    211 - 280
ECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS               281 - 339
//

Text Mined References (21)

PMID Year Title