Property Summary

NCBI Gene PubMed Count 68
Grant Count 79
R01 Count 53
Funding $5,798,009
PubMed Score 134.56
PubTator Score 91.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.000

Synonym

Accession O00755 Q96H90 Q9Y560
Symbols

Gene

PANTHER Protein Class (1)

PDB

4UZQ  

Gene RIF (48)

PMID Text
26388562 Wnt7a is involved in the transformation of the retinal pigment epithelium.
26055144 Wnt7a overexpression is associated with an unfavorable prognosis and that positive Wnt7a may be an independent prognosis factor influencing OS and DFS prediction in colorectal cancer patients.
25978974 this is the first study reporting reduced WNT7A levels in cervical cancer -derived cells and that ectopic WNT7A restoration negatively affects cell proliferation and migration.
25728679 identified Iloprost, a prostacyclin analog, which initiates downstream signaling cascades similar to that of Wnt7a, as a novel inducer of cellular senescence, presenting potential future clinical translational strategies
25705850 Wnt7a has a role in specifying the fate of neural crest-like cells via suppression of notch in the human skin microenvironment
25653486 loss of the Wnt7a gene induced by promoter methylation might be a prognostic factor for non-small cell lung carcinoma
25632963 Prognosis was significantly more favorable for patients with high Wnt7A expression.
25030175 findings suggest a central role of the WNT7A-PAX6 axis in corneal epithelial cell fate determination, and point to a new strategy for treating corneal surface diseases
24711502 Binding of Wnt7a to Fzd7 leads to an activation of noncanonical Wnt signaling, resulting in directed myogenic stem cell migration and enhanced engraftment.
23727605 Novel mutations in the WNT7A gene in two unrelated cases of Al-Awadi Raas-Rothschild syndrome.
More...

AA Sequence

MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGL      1 - 70
DECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQ     71 - 140
YHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCT    141 - 210
TKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEE    211 - 280
DPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK     281 - 349
//

Text Mined References (70)

PMID Year Title
26388562 2015 Effect of hrWnt7a on Human Retinal Pigment Epithelial Cells In Vitro.
26342861 2015 Wnts grasp the WIF domain of Wnt Inhibitory Factor 1 at two distinct binding sites.
26055144 2015 Overexpression of Wnt7? protein predicts poor survival in patients with colorectal carcinoma.
25978974 2015 Expression of WNT genes in cervical cancer-derived cells: Implication of WNT7A in cell proliferation and migration.
25728679 2015 Wnt7a is a novel inducer of ?-catenin-independent tumor-suppressive cellular senescence in lung cancer.
25705850 2015 UV-Induced Wnt7a in the Human Skin Microenvironment Specifies the Fate of Neural Crest-Like Cells via Suppression of Notch.
25653486 2015 Clinical significance of aberrant Wnt7a promoter methylation in human non-small cell lung cancer in Koreans.
25632963 2015 Wnt7A is a putative prognostic and chemosensitivity marker in human malignant pleural mesothelioma.
25030175 2014 WNT7A and PAX6 define corneal epithelium homeostasis and pathogenesis.
24711502 2014 Wnt7a stimulates myogenic stem cell motility and engraftment resulting in improved muscle strength.
More...