Property Summary

NCBI Gene PubMed Count 45
PubMed Score 30.60
PubTator Score 28.56

Knowledge Summary

Patent (2,372)

TINX Plot

  Disease Sources (4)

Disease Target Count
Neoplasm Metastasis 138
Disease Target Count P-value
chronic lymphocytic leukemia 244 1.57877916279212E-10
malignant mesothelioma 3163 2.50302763104626E-7
Waldenstrons macroglobulinemia 765 1.10777997267851E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.21999127563051E-4
pituitary cancer 1972 3.29022684986858E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00147374669869714
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00508657346127907
astrocytic glioma 2241 0.0149903141622304
ependymoma 2514 0.0245794370538529
lung cancer 4473 0.0343245382108028
Disease Target Count Z-score Confidence
ulcerative colitis 2087 0.0 2.0
Disease Target Count Z-score Confidence
Centronuclear myopathy 21 3.167 1.6

Expression

Synonym

Accession O00750 O95666 Q5SW99 PI3K-C2-beta
Symbols C2-PI3K

Gene

PANTHER Protein Class (2)

  Ortholog (8)

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (56)

PMID Text
25622909 PI3KC2B-silencing inhibits early stages of neuroblastoa tumorigenic growth.
24073214 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
23320105 Class II enzyme PI3K-C2beta and the class IB isozyme p110gamma mainly regulate the S1P- and high density lipoprotein (HDL)-dependent endothelial cell (EC) migration and PI3K-C2alpha primarily controls EC survival
23301033 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
23251686 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
23215766 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
23028960 Data suggest a novel role for nucleotide-free Ras in cell signaling in which PI3KC2beta stabilizes nucleotide-free Ras and that interaction of Ras and PI3KC2beta mutually inhibit one another.
22825724 The results of this study showed that strong association between PIK3C2B gene alternation and high-grade oligodendroglial tumors.
22128329 These findings provide a unique mechanism for regulating class II PI3Ks, and identify TRIM27 as a previously undescribed negative regulator of CD4 T cells.
21986133 Overexpression of PIK3C2B is associated with esophageal squamous cell carcinoma.
More...

AA Sequence

MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSK      1 - 70
PAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGSDPWPKGSLSGDYLYIFDGSDGGVSS     71 - 140
SPGPGDIEGSCKKLSPPPLPPRASIWDTPPLPPRKGSPSSSKISQPSDINTFSLVEQLPGKLLEHRILEE    141 - 210
EEVLGGGGQGRLLGSVDYDGINDAITRLNLKSTYDAEMLRDATRGWKEGRGPLDFSKDTSGKPVARSKTM    211 - 280
PPQVPPRTYASRYGNRKNATPGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDILRSGS    281 - 350
DIQDYFLTGYVWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCYTHDDLRNVD    351 - 420
VGDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFDIDIRLQLMEQKVVRSDLARTVNDDQSPSTLNYLVHL    421 - 490
QERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAICNALAAVETPEITSALNQLPP    491 - 560
CPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELYCNTFNADFQTAVPGSRKHDLVQEACHFARS    561 - 630
LAFTVYATHRIPIIWATSYEDFYLSCSLSHGGKELCSPLQTRRAHFSKYLFHLIVWDQQICFPVQVNRLP    631 - 700
RETLLCATLYALPIPPPGSSSEANKQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQENPSARWSA    701 - 770
PNFHQPDSVILQIDFPTSAFDIKFTSPPGDKFSPRYEFGSLREEDQRKLKDIMQKESLYWLTDADKKRLW    771 - 840
EKRYYCHSEVSSLPLVLASAPSWEWACLPDIYVLLKQWTHMNHQDALGLLHATFPDQEVRRMAVQWIGSL    841 - 910
SDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKDGLKDSQFSIRYQYLLAALLC    911 - 980
CCGKGLREEFNRQCWLVNALAKLAQQVREAAPSARQGILRTGLEEVKQFFALNGSCRLPLSPSLLVKGIV    981 - 1050
PRDCSYFNSNAVPLKLSFQNVDPLGENIRVIFKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCF   1051 - 1120
STGRGRGMVEMIPNAETLRKIQVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYV   1121 - 1190
LGICDRHNDNIMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDL   1191 - 1260
CCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLIESSLGSVATK   1261 - 1330
LNFFIHNLAQMKFTGSDDRLTLSFASRTHTLKSSGRISDVFLCRHEKIFHPNKGYIYVVKVMRENTHEAT   1331 - 1400
YIQRTFEEFQELHNKLRLLFPSSHLPSFPSRFVIGRSRGEAVAERRREELNGYIWHLIHAPPEVAECDLV   1401 - 1470
YTFFHPLPRDEKAMGTSPAPKSSDGTWARPVGKVGGEVKLSISYKNNKLFIMVMHIRGLQLLQDGNDPDP   1471 - 1540
YVKIYLLPDPQKTTKRKTKVARKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVNIR   1541 - 1610
LRELDLAQEKTGWFALGSRSHGTL                                                 1611 - 1634
//

Text Mined References (46)

PMID Year Title
25622909 2015 Phosphatidylinositol 3-kinase, class 2 beta (PI3KC2?) isoform contributes to neuroblastoma tumorigenesis.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
23535733 2013 Genome-wide association studies identify four ER negative-specific breast cancer risk loci.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23320105 2013 Class II phosphoinositide 3-kinases contribute to endothelial cells morphogenesis.
23028960 2012 A new dimension to Ras function: a novel role for nucleotide-free Ras in Class II phosphatidylinositol 3-kinase beta (PI3KC2?) regulation.
22825724 2012 Identification of a novel population in high-grade oligodendroglial tumors not deleted on 1p/19q using array CGH.
22128329 2011 Tripartite motif containing protein 27 negatively regulates CD4 T cells by ubiquitinating and inhibiting the class II PI3K-C2?.
21986133 2011 Phosphatidylinositol 3-kinase-C2? inhibits cisplatin-mediated apoptosis via the Akt pathway in oesophageal squamous cell carcinoma.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
More...