Property Summary

NCBI Gene PubMed Count 56
Grant Count 69
R01 Count 35
Funding $12,463,205.25
PubMed Score 251.92
PubTator Score 318.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession O00748 A8K367 Q16859 Q5MAB8 Q7Z366 Q8IUP4 Q8TCP8
Symbols iCE
CE-2
PCE-2
CES2A1

Gene

PANTHER Protein Class (2)

Gene RIF (44)

PMID Text
26025324 Findings suggest that CES2 expression and activity, by mediating the intratumoral activation of irinotecan, is a contributor to FOLFIRINOX sensitivity in pancreatic cancer.
25724353 In the liver and duodenum, CES2 mRNA expression increased and exhibited a postnatal surge.
24212379 After oral administration of dabigatran etexilate to humans, DABE is hydrolyzed by intestinal CES2 to the intermediate M2 metabolite followed by hydrolysis of M2 to DAB in the liver by CES1.
24195516 expression of CES2, UGTA1A1, and GUSB varies in colorectal pathology tissues and that the expression of CES2 is somewhat related to tumor staging.
23480903 CES2 RNA expression was observed in neuroblastoma cells, and its expression in neuroblastoma cell lines was positively correlated with sensitivity to CPT-11 and apoptosis after CPT-11 exposure in vitro
23471941 Variations in CES2 in the promoter region, may alter rifampicin metabolism by affecting expression of the gene
22525521 tested the hypothesis that an individual's CES phenotype can be characterized by reporter substrates/probes that interrogate native CES1 and CES2 activities in liver and immunoblotting methods
20649590 Report CES2 mediated hydrolysis of heroin, cocaine and CPT-11.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGP      1 - 70
LRFAPPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNL     71 - 140
PVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQ    141 - 210
NIAHFGGNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSAC    211 - 280
DQVDSEALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLI    281 - 350
PKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPA    351 - 420
LQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKY    421 - 490
WANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHTEL     491 - 559
//

Text Mined References (61)

PMID Year Title
26025324 2015 Carboxylesterase 2 as a Determinant of Response to Irinotecan and Neoadjuvant FOLFIRINOX Therapy in Pancreatic Ductal Adenocarcinoma.
25724353 2015 Ontogenic expression of human carboxylesterase-2 and cytochrome P450 3A4 in liver and duodenum: postnatal surge and organ-dependent regulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24212379 2014 Identification of carboxylesterase-dependent dabigatran etexilate hydrolysis.
24195516 2014 Relationship between the expression of CES2, UGT1A1, and GUSB in colorectal cancer tissues and aberrant methylation.
23480903 2013 Clinical implications of CES2 RNA expression in neuroblastoma.
23471941 2013 Relationship between CES2 genetic variations and rifampicin metabolism.
22525521 2012 Examination of the carboxylesterase phenotype in human liver.
21269460 2011 Initial characterization of the human central proteome.
20931200 2010 Recommended nomenclature for five mammalian carboxylesterase gene families: human, mouse, and rat genes and proteins.
More...