Property Summary

Ligand Count 91
NCBI Gene PubMed Count 62
PubMed Score 271.08
PubTator Score 318.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease -1.014 1.7e-02
acute quadriplegic myopathy 1.461 4.4e-06
Becker muscular dystrophy 1.065 5.0e-05
colon cancer -1.700 7.5e-03
intraductal papillary-mucinous neoplasm ... 2.300 2.4e-03
osteosarcoma -1.580 8.5e-03
ovarian cancer 1.300 1.5e-05
pancreatic ductal adenocarcinoma liver m... -1.235 4.0e-02
ulcerative colitis -1.700 1.8e-05

Protein-protein Interaction (6)

Gene RIF (49)

AA Sequence

MRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGP      1 - 70
LRFAPPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNL     71 - 140
PVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQ    141 - 210
NIAHFGGNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSAC    211 - 280
DQVDSEALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLI    281 - 350
PKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPA    351 - 420
LQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKY    421 - 490
WANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHTEL     491 - 559
//

Text Mined References (67)

PMID Year Title