Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
R01 Count 2
Funding $168,437.5
PubMed Score 51.80
PubTator Score 67.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
astrocytoma 1.100 0.000
oligodendroglioma 1.100 0.000
osteosarcoma -1.424 0.000
glioblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
medulloblastoma, large-cell 1.100 0.000
primary pancreatic ductal adenocarcinoma 1.007 0.029
lung cancer 1.700 0.000
pediatric high grade glioma 1.300 0.000
non primary Sjogren syndrome sicca 1.100 0.036
Breast cancer 1.200 0.000
pituitary cancer 1.100 0.000

Synonym

Accession O00746 A2IDD0 Q5U0M9 NDK
Symbols NDPK-D
NM23H4
nm23-H4

Gene

 Grant Application (2)

PDB

1EHW  

Gene RIF (7)

PMID Text
25233933 miR-196 performed it's their function by inhibiting NME4 expression and further activating p-JNK, suppressing TIMP1, and augmenting MMP1/9.
25231795 Mitochondrial NM23-H4/NDPK-D: a bifunctional nanoswitch for bioenergetics and lipid signaling
25010650 NDPK-B and NDPK-D were shown to bind efficiently to liposomes mimicking plasma membrane and mitochondrial inner membrane
24970086 findings show NDPKs (NM23-H1/H2/H4) interact with and provide GTP to dynamins, allowing these motor proteins to work with high thermodynamic efficiency for membrane remodeling
23150663 Nm23-H4 acts as a lipid-dependent mitochondrial switch with dual function in phosphotransfer serving local GTP supply and cardiolipin transfer for apoptotic signaling and putative other functions
20877624 Observational study of gene-disease association. (HuGE Navigator)
18604718 High expression of ERCC1, FLT1, NME4 and PCNA in myelodysplastic syndrome was associated with poor prognosis and disease progression along the sequence of 5q-syndrome/RCMD/RAEB/de novo AML

AA Sequence

MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVG      1 - 70
MKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGD     71 - 140
FSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA                           141 - 187
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25233933 2014 OncomiR-196 promotes an invasive phenotype in oral cancer through the NME4-JNK-TIMP1-MMP signaling pathway.
25231795 2015 Mitochondrial NM23-H4/NDPK-D: a bifunctional nanoswitch for bioenergetics and lipid signaling.
25010650 2014 Structural comparison of highly similar nucleoside-diphosphate kinases: Molecular explanation of distinct membrane-binding behavior.
24970086 2014 Membrane trafficking. Nucleoside diphosphate kinases fuel dynamin superfamily proteins with GTP for membrane remodeling.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23150663 2013 Dual function of mitochondrial Nm23-H4 protein in phosphotransfer and intermembrane lipid transfer: a cardiolipin-dependent switch.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
More...