Property Summary

NCBI Gene PubMed Count 24
PubMed Score 56.42
PubTator Score 67.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.100 6.8e-29
atypical teratoid / rhabdoid tumor 2.000 4.8e-10
Breast cancer 1.200 5.7e-12
glioblastoma 1.100 1.3e-04
lung cancer 1.700 3.6e-05
malignant mesothelioma 1.200 9.3e-06
medulloblastoma, large-cell 1.100 1.3e-04
non primary Sjogren syndrome sicca 1.100 3.6e-02
oligodendroglioma 1.100 3.7e-18
osteosarcoma -1.424 1.7e-05
pediatric high grade glioma 1.300 2.8e-04
pituitary cancer 1.100 1.3e-04
primary pancreatic ductal adenocarcinoma 1.007 2.9e-02

Gene RIF (8)

AA Sequence

MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVG      1 - 70
MKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGD     71 - 140
FSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA                           141 - 187
//

Text Mined References (26)

PMID Year Title