Property Summary

NCBI Gene PubMed Count 41
PubMed Score 107.30
PubTator Score 64.80

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count P-value
ovarian cancer 8492 5.47817971569917E-11
pilocytic astrocytoma 3086 2.62426425022205E-4
pediatric high grade glioma 2712 3.16266106238526E-4
glioblastoma 5572 8.24810033832905E-4
sonic hedgehog group medulloblastoma 1482 0.00127277383846966
astrocytoma 1493 0.00159548695309869
osteosarcoma 7933 0.00707194433925219
Disease Target Count Z-score Confidence
Osteoporosis 259 3.305 1.7
Obesity 616 3.255 1.6
Cancer 2346 3.041 1.5


  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.300 0.001
osteosarcoma 1.115 0.007
sonic hedgehog group medulloblastoma -1.300 0.001
astrocytoma -1.400 0.002
pediatric high grade glioma -1.100 0.000
pilocytic astrocytoma -1.200 0.000
ovarian cancer 1.300 0.000


Accession O00744 B2R7A5 O00747 Q4VAJ4 Q4VAJ5 Q8WZ97
Symbols SHFM6


PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Pig OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 IMPC Term (1)

Gene RIF (31)

26370090 WNT10B enhances proliferation through beta-catenin and RAC1 GTPase in human corneal endothelial cells.
26338900 Data show that Wnt protein Wnt10b is expressed in cardiomyocytes and localized in the intercalated discs of mouse and human hearts.
25995040 these findings clearly demonstrate that Wnt10b promotes epidermal keratinocyte transformation through induced Egf pathway
24211389 Sequence analysis of WNT10B gene revealed a novel 4-bp deletion mutation.
23900840 Hypoxia-inducible factor-2alpha-dependent hypoxic induction of Wnt10b expression in adipogenic cells.
23325361 No association between WNT10B polymorphisms and adiposity parameters was found. However, a role for WNT10B variants in determining human bone mineral density was found.
23307470 WNT10B/beta-catenin signalling induces HMGA2 and proliferation in metastatic breast cancer tumours devoid of ERalpha, PR and HER2 expression.
23135473 Results suggest that Wnt10b likely plays an important role in the development of endometrial cancer (EC). The results also identify a role for Wnt10b in EC cells through promoting proliferation and inhibiting apoptosis.
23104151 Variations in WNT10B do not contribute to human monogenic obesity in our population.
22890324 we identified WNT10B as a direct target of miR-148a in cancer-associated fibroblasts from endometrial cancers

AA Sequence

RGHNVLRQTRVERCHCRFHWCCYVLCDECKVTEWVNVCK                                   351 - 389

Text Mined References (44)

PMID Year Title
26370090 2015 WNT10B enhances proliferation through ?-catenin and RAC1 GTPase in human corneal endothelial cells.
26338900 2015 Wnt10b Gain-of-Function Improves Cardiac Repair by Arteriole Formation and Attenuation of Fibrosis.
25995040 2015 Prolonged overexpression of Wnt10b induces epidermal keratinocyte transformation through activating EGF pathway.
24211389 2014 Novel homozygous mutations in the WNT10B gene underlying autosomal recessive split hand/foot malformation in three consanguineous families.
23900840 2013 Hypoxia-inducible factor-2?-dependent hypoxic induction of Wnt10b expression in adipogenic cells.
23325361 2013 Genetic association study of WNT10B polymorphisms with BMD and adiposity parameters in Danish and Belgian males.
23307470 2013 WNT10B/?-catenin signalling induces HMGA2 and proliferation in metastatic triple-negative breast cancer.
23135473 2013 Expression and the clinical significance of Wnt10a and Wnt10b in endometrial cancer are associated with the Wnt/?-catenin pathway.
23104151 2013 Mutation analysis of WNT10B in obese children, adolescents and adults.
22890324 2013 Silencing of miR-148a in cancer-associated fibroblasts results in WNT10B-mediated stimulation of tumor cell motility.