Property Summary

NCBI Gene PubMed Count 43
PubMed Score 120.68
PubTator Score 64.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma -1.400 1.6e-03
Astrocytoma, Pilocytic -1.200 3.7e-04
glioblastoma -1.100 1.8e-04
group 3 medulloblastoma -1.100 3.5e-02
osteosarcoma 1.115 7.1e-03
ovarian cancer 1.300 5.5e-11
pediatric high grade glioma -1.100 3.2e-04

Protein-protein Interaction (5)

Gene RIF (33)

AA Sequence

MLEEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLGLCLRNPDVTA      1 - 70
SALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGK     71 - 140
LVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFS    141 - 210
RDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLG    211 - 280
RAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCG    281 - 350
RGHNVLRQTRVERCHCRFHWCCYVLCDECKVTEWVNVCK                                   351 - 389
//

Text Mined References (47)

PMID Year Title