Property Summary

NCBI Gene PubMed Count 38
PubMed Score 208.54
PubTator Score 31.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 9.6e-05
dermatomyositis -1.300 2.1e-03
glioblastoma -1.100 9.5e-03
invasive ductal carcinoma -1.500 1.1e-02
medulloblastoma, large-cell -1.400 3.5e-05
Multiple myeloma 1.340 4.5e-04
osteosarcoma 1.453 2.4e-05
ovarian cancer -2.000 2.4e-09
pancreatic ductal adenocarcinoma liver m... -1.006 3.8e-02

Gene RIF (23)

AA Sequence

MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQ      1 - 70
VPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWR     71 - 140
YCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPR    141 - 210
GAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTR    211 - 280
EPKLFRAVPDSERVIPPRTTTPYFL                                                 281 - 305
//

Text Mined References (44)

PMID Year Title