Property Summary

NCBI Gene PubMed Count 35
Grant Count 35
R01 Count 24
Funding $2,062,179.47
PubMed Score 71.09
PubTator Score 31.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 2.081 0.001
osteosarcoma 1.453 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.100 0.010
medulloblastoma, large-cell -1.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.077 0.031
invasive ductal carcinoma -1.500 0.011
ovarian cancer -2.600 0.000
dermatomyositis -1.300 0.002

Gene RIF (21)

PMID Text
27026398 findings suggest that BRCA1 is a novel modulator of PP6 signalling via its interaction with ANKRD28.
26462736 Data show 408 phosphopeptides on 272 proteins that increased and 298 phosphopeptides on 220 proteins that decreased in phosphorylation upon catalytic subunit of rotein phosphatase 6 (PP6c) depletion in mitotic cells.
26138368 Protein phosphatase 6 (ppp6c), a negative regulator that restricts the G1 to S phase progression, is diminished in human psoriatic epidermis and is directly targeted by miR-31.
25999147 PP6 is involved in a diverse set of biological pathways.
25187537 These results suggest that human PP6 interacts with and positively regulates the activity of the influenza A virus RNA-dependent RNA polymerase.
24336958 PP6C mutations have distinct functional and clinical consequences in melanoma, and confer sensitivity to Aurora A kinase inhibitors.
24064353 PP2A holoenzyme and PP6 were found stably associated with U1 snRNP; findings indicate that these phosphatases regulate splicing catalysis involving U1 snRNP and suggest an important evolutionary conserved role of PP2A family phosphatases in pre-mRNA splicing
24063632 PP6c associates with E-cadherin in adherens junctions and is required to oppose casein kinase-1 to maintain cell surface localization of E-cadherin.
23864707 Results show that Sit4p and its mammalian orthologue, PP6, regulate traffic from the ER to the Golgi complex which is consistent with its role in coat recycling.
23729733 Findings support the view that formation of micronuclei rather than chromosome instability alone explains how loss of PPP6C, and more generally mitotic spindle and centrosome defects, can act as drivers for genome instability in melanoma.
More...

AA Sequence

MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQ      1 - 70
VPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWR     71 - 140
YCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPR    141 - 210
GAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTR    211 - 280
EPKLFRAVPDSERVIPPRTTTPYFL                                                 281 - 305
//

Text Mined References (41)

PMID Year Title
27026398 2016 BRCA1 affects protein phosphatase 6 signalling through its interaction with ANKRD28.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26462736 2015 Quantitative phosphoproteomics reveals new roles for the protein phosphatase PP6 in mitotic cells.
26138368 2015 NF-?B-induced microRNA-31 promotes epidermal hyperplasia by repressing protein phosphatase 6 in psoriasis.
25999147 2015 Adaptation of HepG2 cells to a steady-state reduction in the content of protein phosphatase 6 (PP6) catalytic subunit.
25187537 2014 Interactome analysis of the influenza A virus transcription/replication machinery identifies protein phosphatase 6 as a cellular factor required for efficient virus replication.
24336958 2014 PP6C hotspot mutations in melanoma display sensitivity to Aurora kinase inhibition.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
More...