Property Summary

NCBI Gene PubMed Count 106
Grant Count 73
R01 Count 36
Funding $6,178,024.73
PubMed Score 120.71
PubTator Score 140.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O00716 Q15000 Q68DT0 Q9BZ44 E2F-3
Symbols E2F-3

Gene

PANTHER Protein Class (1)

Gene RIF (64)

PMID Text
26722476 miR-503 inhibits cell proliferation and induces apoptosis by directly targeting E2F3 in colorectal cancer cells.
26512919 E2F3 silencing decreases Her2-positive mammary tumor growth by reducing percentage of cells undergoing mitosis.
26315541 mirn424 has a role in inhibiting Akt3/E2F3 axis and tumor growth in hepatocellular carcinoma
26233544 In gastric cancer miR-141 could be interacting with MEG3 and targeting E2F3 to inhibit cell proliferation.
26145228 E2F1 and E2F3 are present within the syncytiotrophoblast of placenta and that E2F1 is reduced in preeclampsia. Although silencing of either E2F1 or E2F3 does not alter MMP14 expression, both appear to regulate soluble endoglin release.
25889255 MiR-377 is an important negative regulator of E2F and MAP3K7/NF-kB signaling pathway in melanoma cells.
25846116 our study demonstrated that miR-34c plays a role of tumor suppressor in HEC-1-B cells, and E2F3 protein may be a target of miR-34c.
25762621 miR-145 expression was lower in tumors compared with matched normal samples and correlated with increased the E2F3 transcription factor protein staining.
25712098 Data suggest that aberrant cell cycle activation in Ewing sarcoma is due to the de-repression of transcription factor E2F targets of transcriptional induction and physical recruitment of E2F3 by fusion protein EWS-FLI1 replacing E2F4 on their promoters.
25515700 MiR-203 sensitizes glioma cells to temozolomide and inhibits glioma cell invasion by targeting E2F3.
More...

AA Sequence

MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQILTTNTSTTSC      1 - 70
SSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALGRGGSGGGGGPPAKRRLELGE     71 - 140
SGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEV    141 - 210
LKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSC    211 - 280
TLDLKLLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYL    281 - 350
CPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEG    351 - 420
PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS                             421 - 465
//

Text Mined References (107)

PMID Year Title
26722476 2015 miR-503 inhibits cell proliferation and induces apoptosis in colorectal cancer cells by targeting E2F3.
26512919 2015 Silencing of E2F3 suppresses tumor growth of Her2+ breast cancer cells by restricting mitosis.
26315541 2015 MicroRNA-424 inhibits Akt3/E2F3 axis and tumor growth in hepatocellular carcinoma.
26233544 2015 MiR-141 Inhibits Gastric Cancer Proliferation by Interacting with Long Noncoding RNA MEG3 and Down-Regulating E2F3 Expression.
26145228 2015 Transcription factors E2F1 and E2F3 are expressed in placenta but do not regulate MMP14.
25889255 2015 MiR-377 targets E2F3 and alters the NF-kB signaling pathway through MAP3K7 in malignant melanoma.
25846116 2015 miR-34c plays a role of tumor suppressor in HEC?1-B cells by targeting E2F3 protein.
25762621 2015 miR-145 mediates the antiproliferative and gene regulatory effects of vitamin D3 by directly targeting E2F3 in gastric cancer cells.
25712098 2015 EWS-FLI1 employs an E2F switch to drive target gene expression.
25515700 2015 MiR-203 sensitizes glioma cells to temozolomide and inhibits glioma cell invasion by targeting E2F3.
More...