Tbio | Transcription factor E2F3 |
Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F3 binds specifically to RB1 in a cell-cycle dependent manner. Inhibits adipogenesis, probably through the repression of CEBPA binding to its target gene promoters (By similarity).
This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]
This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]
Comments
Disease | Target Count | P-value |
---|---|---|
Breast cancer | 3099 | 3.1150770611006E-6 |
malignant mesothelioma | 3163 | 3.95979863157439E-6 |
Atopic dermatitis | 944 | 1.38995975230736E-5 |
lung cancer | 4473 | 3.31252275230757E-5 |
ductal carcinoma in situ | 1745 | 5.58747468684871E-5 |
osteosarcoma | 7933 | 3.29381118019425E-4 |
nasopharyngeal carcinoma | 1056 | 6.84079423045698E-4 |
cutaneous lupus erythematosus | 1056 | 0.00236410165259509 |
colon cancer | 1475 | 0.00419048415946042 |
dermatomyositis | 967 | 0.00688942291171792 |
esophageal adenocarcinoma | 737 | 0.020206322103253 |
non primary Sjogren syndrome sicca | 840 | 0.0211228882563321 |
Rheumatoid Arthritis | 1171 | 0.0229639961613332 |
gastric carcinoma | 832 | 0.02613879675865 |
subependymal giant cell astrocytoma | 2287 | 0.0298187580539696 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 0.0301749568185556 |
group 3 medulloblastoma | 2254 | 0.0312471239356895 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 0.0320509028416973 |
Disease | log2 FC | p |
---|---|---|
Rheumatoid Arthritis | 1.200 | 0.023 |
malignant mesothelioma | 1.200 | 0.000 |
esophageal adenocarcinoma | 1.200 | 0.020 |
cutaneous lupus erythematosus | 1.100 | 0.002 |
osteosarcoma | -1.791 | 0.000 |
group 3 medulloblastoma | 1.400 | 0.031 |
Atopic dermatitis | 1.100 | 0.000 |
intraductal papillary-mucinous adenoma (... | 1.500 | 0.032 |
intraductal papillary-mucinous carcinoma... | 1.700 | 0.030 |
lung cancer | 2.000 | 0.000 |
colon cancer | 1.100 | 0.004 |
non primary Sjogren syndrome sicca | -1.100 | 0.021 |
subependymal giant cell astrocytoma | 1.666 | 0.030 |
nasopharyngeal carcinoma | 1.100 | 0.001 |
gastric carcinoma | 1.400 | 0.026 |
ductal carcinoma in situ | 1.300 | 0.000 |
Breast cancer | 1.800 | 0.000 |
dermatomyositis | 1.100 | 0.007 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26722476 | miR-503 inhibits cell proliferation and induces apoptosis by directly targeting E2F3 in colorectal cancer cells. |
26512919 | E2F3 silencing decreases Her2-positive mammary tumor growth by reducing percentage of cells undergoing mitosis. |
26315541 | mirn424 has a role in inhibiting Akt3/E2F3 axis and tumor growth in hepatocellular carcinoma |
26233544 | In gastric cancer miR-141 could be interacting with MEG3 and targeting E2F3 to inhibit cell proliferation. |
26145228 | E2F1 and E2F3 are present within the syncytiotrophoblast of placenta and that E2F1 is reduced in preeclampsia. Although silencing of either E2F1 or E2F3 does not alter MMP14 expression, both appear to regulate soluble endoglin release. |
25889255 | MiR-377 is an important negative regulator of E2F and MAP3K7/NF-kB signaling pathway in melanoma cells. |
25846116 | our study demonstrated that miR-34c plays a role of tumor suppressor in HEC-1-B cells, and E2F3 protein may be a target of miR-34c. |
25762621 | miR-145 expression was lower in tumors compared with matched normal samples and correlated with increased the E2F3 transcription factor protein staining. |
25712098 | Data suggest that aberrant cell cycle activation in Ewing sarcoma is due to the de-repression of transcription factor E2F targets of transcriptional induction and physical recruitment of E2F3 by fusion protein EWS-FLI1 replacing E2F4 on their promoters. |
25515700 | MiR-203 sensitizes glioma cells to temozolomide and inhibits glioma cell invasion by targeting E2F3. |
More... |
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQILTTNTSTTSC 1 - 70 SSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALGRGGSGGGGGPPAKRRLELGE 71 - 140 SGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEV 141 - 210 LKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSC 211 - 280 TLDLKLLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYL 281 - 350 CPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEG 351 - 420 PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS 421 - 465 //
PMID | Year | Title |
---|---|---|
26722476 | 2015 | miR-503 inhibits cell proliferation and induces apoptosis in colorectal cancer cells by targeting E2F3. |
26512919 | 2015 | Silencing of E2F3 suppresses tumor growth of Her2+ breast cancer cells by restricting mitosis. |
26315541 | 2015 | MicroRNA-424 inhibits Akt3/E2F3 axis and tumor growth in hepatocellular carcinoma. |
26233544 | 2015 | MiR-141 Inhibits Gastric Cancer Proliferation by Interacting with Long Noncoding RNA MEG3 and Down-Regulating E2F3 Expression. |
26145228 | 2015 | Transcription factors E2F1 and E2F3 are expressed in placenta but do not regulate MMP14. |
25889255 | 2015 | MiR-377 targets E2F3 and alters the NF-kB signaling pathway through MAP3K7 in malignant melanoma. |
25846116 | 2015 | miR-34c plays a role of tumor suppressor in HEC?1-B cells by targeting E2F3 protein. |
25762621 | 2015 | miR-145 mediates the antiproliferative and gene regulatory effects of vitamin D3 by directly targeting E2F3 in gastric cancer cells. |
25712098 | 2015 | EWS-FLI1 employs an E2F switch to drive target gene expression. |
25515700 | 2015 | MiR-203 sensitizes glioma cells to temozolomide and inhibits glioma cell invasion by targeting E2F3. |
More... |