| Tbio | Transcription factor E2F3 |
Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F3 binds specifically to RB1 in a cell-cycle dependent manner. Inhibits adipogenesis, probably through the repression of CEBPA binding to its target gene promoters (By similarity).
This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]
This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| Breast cancer | 3578 | 3.1e-06 |
| malignant mesothelioma | 3232 | 4.0e-06 |
| Atopic dermatitis | 952 | 1.4e-05 |
| ductal carcinoma in situ | 1745 | 5.6e-05 |
| osteosarcoma | 7950 | 3.3e-04 |
| nasopharyngeal carcinoma | 1058 | 6.8e-04 |
| lung cancer | 4740 | 1.1e-03 |
| cutaneous lupus erythematosus | 1057 | 2.4e-03 |
| colon cancer | 1478 | 4.2e-03 |
| dermatomyositis | 966 | 6.9e-03 |
| esophageal adenocarcinoma | 737 | 2.0e-02 |
| non primary Sjogren syndrome sicca | 891 | 2.1e-02 |
| Rheumatoid arthritis | 1191 | 2.3e-02 |
| gastric carcinoma | 807 | 2.6e-02 |
| subependymal giant cell astrocytoma | 2287 | 3.0e-02 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 3.0e-02 |
| group 3 medulloblastoma | 4104 | 3.1e-02 |
| intraductal papillary-mucinous adenoma (IPMA) | 2955 | 3.2e-02 |
| Disease | log2 FC | p |
|---|---|---|
| Atopic dermatitis | 1.100 | 1.4e-05 |
| Breast cancer | 1.800 | 3.1e-06 |
| colon cancer | 1.100 | 4.2e-03 |
| cutaneous lupus erythematosus | 1.100 | 2.4e-03 |
| dermatomyositis | 1.100 | 6.9e-03 |
| ductal carcinoma in situ | 1.300 | 5.6e-05 |
| esophageal adenocarcinoma | 1.200 | 2.0e-02 |
| gastric carcinoma | 1.400 | 2.6e-02 |
| group 3 medulloblastoma | 1.400 | 3.1e-02 |
| intraductal papillary-mucinous adenoma (... | 1.500 | 3.2e-02 |
| intraductal papillary-mucinous carcinoma... | 1.700 | 3.0e-02 |
| lung cancer | 1.500 | 1.1e-03 |
| malignant mesothelioma | 1.200 | 4.0e-06 |
| nasopharyngeal carcinoma | 1.100 | 6.8e-04 |
| non primary Sjogren syndrome sicca | -1.100 | 2.1e-02 |
| osteosarcoma | -1.791 | 3.3e-04 |
| Rheumatoid arthritis | 1.200 | 2.3e-02 |
| subependymal giant cell astrocytoma | 1.666 | 3.0e-02 |
| Species | Source | Disease |
|---|---|---|
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA |
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQILTTNTSTTSC 1 - 70 SSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALGRGGSGGGGGPPAKRRLELGE 71 - 140 SGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEV 141 - 210 LKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSC 211 - 280 TLDLKLLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYL 281 - 350 CPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEG 351 - 420 PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS 421 - 465 //
