Property Summary

NCBI Gene PubMed Count 114
PubMed Score 133.33
PubTator Score 140.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Atopic dermatitis 1.100 1.4e-05
Breast cancer 1.800 3.1e-06
colon cancer 1.100 4.2e-03
cutaneous lupus erythematosus 1.100 2.4e-03
dermatomyositis 1.100 6.9e-03
ductal carcinoma in situ 1.300 5.6e-05
esophageal adenocarcinoma 1.200 2.0e-02
gastric carcinoma 1.400 2.6e-02
group 3 medulloblastoma 1.400 3.1e-02
intraductal papillary-mucinous adenoma (... 1.500 3.2e-02
intraductal papillary-mucinous carcinoma... 1.700 3.0e-02
lung cancer 1.500 1.1e-03
malignant mesothelioma 1.200 4.0e-06
nasopharyngeal carcinoma 1.100 6.8e-04
non primary Sjogren syndrome sicca -1.100 2.1e-02
osteosarcoma -1.791 3.3e-04
Rheumatoid arthritis 1.200 2.3e-02
subependymal giant cell astrocytoma 1.666 3.0e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (69)

AA Sequence

MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQILTTNTSTTSC      1 - 70
SSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALGRGGSGGGGGPPAKRRLELGE     71 - 140
SGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEV    141 - 210
LKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSC    211 - 280
TLDLKLLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYL    281 - 350
CPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEG    351 - 420
PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS                             421 - 465
//

Text Mined References (115)

PMID Year Title