Property Summary

NCBI Gene PubMed Count 38
Grant Count 40
R01 Count 25
Funding $3,269,601.8
PubMed Score 89.80
PubTator Score 56.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
gastric cancer 1.100 0.001
pancreatic cancer 1.100 0.003
urothelial carcinoma -1.100 0.019
malignant mesothelioma -1.800 0.000
astrocytic glioma 1.700 0.018
ependymoma 1.900 0.007
oligodendroglioma 1.600 0.006
psoriasis -3.600 0.000
cutaneous lupus erythematosus -1.400 0.003
osteosarcoma -1.721 0.015
group 4 medulloblastoma 3.200 0.000
atypical teratoid/rhabdoid tumor 1.200 0.002
medulloblastoma, large-cell 1.200 0.014
intraductal papillary-mucinous adenoma (... 2.500 0.001
lung cancer 1.300 0.002
breast carcinoma -1.900 0.000
pediatric high grade glioma 1.200 0.020
pancreatic carcinoma 1.100 0.003
lung adenocarcinoma -1.200 0.000
invasive ductal carcinoma -1.700 0.012
Breast cancer -3.200 0.000
lung carcinoma -2.200 0.000
Pick disease 1.500 0.000
ductal carcinoma in situ -1.200 0.004
ovarian cancer -3.100 0.000
pituitary cancer -2.200 0.000
dermatomyositis 1.200 0.001

Gene RIF (26)

PMID Text
26677878 In benign prostatic hyperplasia, luminal NFIB loss correlated with more severe disease. in androgen-dependent LNCaP prostate cancer cells demonstrated that 64.3% of NFIB binding sites are associated with AR and FOXA1 binding sites.
26631609 Our study defines new molecular subclasses of ACC characterized by MYBL1 rearrangements and 5'-NFIB gene fusions.
26084801 These data suggest that germline genetic variation at rs7034162 is important in osteosarcoma metastasis and that NFIB is an osteosarcoma metastasis susceptibility gene.
25764026 multivariate analysis co-overexpression of NFIB, RANK and RANKL significantly increased the risk of metastasis with an odds ratio of 13.59
25664610 Knockdown of NFI-B by shRNA enhances HIV-1 replication in peripheral blood mononuclear cells (PBMCs) and in Jurkat cells
25220407 TGF-beta-mediated suppression of ANT2 through NF1/Smad4 complexes contributes to oxidative stress and DNA damage during induction of cellular senescence.
24949940 Further studies also discovered a conserved feedback regulatory circuitry formed by NFIB and miR-365 in cutaneous squamous cell carcinoma development
23161775 Increased expression of NF1B is associated with pilocytic astrocytoma.
22505352 Explored copy number alterations rearrangements in adenoid cystic carcinoma. 86% of the tumors expressed MYB-NFIB fusion transcripts and 97% overexpressed MYB mRNA.
22180456 The data demonstrates that the autism spectrum disorder-associated A-C intronic haplotype of the ENGRAILED2 gene is a transcriptional activator, and both CUX1 and NFIB mediate this activity.
More...

AA Sequence

MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQ      1 - 70
KWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKG     71 - 140
IPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLED    141 - 210
SFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDEN    211 - 280
MEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV    281 - 350
AHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQSWYLG    351 - 420
//

Text Mined References (44)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26677878 2016 Nfib Regulates Transcriptional Networks That Control the Development of Prostatic Hyperplasia.
26631609 2016 Novel MYBL1 Gene Rearrangements with Recurrent MYBL1-NFIB Fusions in Salivary Adenoid Cystic Carcinomas Lacking t(6;9) Translocations.
26084801 2015 A Genome-Wide Scan Identifies Variants in NFIB Associated with Metastasis in Patients with Osteosarcoma.
25764026 2015 Prognostic role of nuclear factor/IB and bone remodeling proteins in metastatic giant cell tumor of bone: A retrospective study.
25220407 2014 TGF-?/NF1/Smad4-mediated suppression of ANT2 contributes to oxidative stress in cellular senescence.
24949940 2014 miR-365 promotes cutaneous squamous cell carcinoma (CSCC) through targeting nuclear factor I/B (NFIB).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23419831 2014 APOE and BCHE as modulators of cerebral amyloid deposition: a florbetapir PET genome-wide association study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...