Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.14
PubTator Score 7.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia 1.400 3.9e-02
adult high grade glioma 1.300 6.1e-04
Astrocytoma, Pilocytic 1.400 1.6e-07
cutaneous lupus erythematosus 1.400 1.3e-04
dermatomyositis 1.700 2.4e-03
Duchenne muscular dystrophy 1.019 5.9e-08
gastric carcinoma 1.100 2.1e-02
glioblastoma 1.200 1.1e-04
intraductal papillary-mucinous adenoma (... 1.100 2.1e-02
intraductal papillary-mucinous carcinoma... 1.200 3.0e-02
juvenile dermatomyositis 1.618 3.8e-13
lung cancer -2.200 9.0e-05
lung carcinoma -1.300 9.7e-28
osteosarcoma 1.516 7.5e-06
ovarian cancer -1.100 6.5e-06
pancreatic ductal adenocarcinoma liver m... 1.615 2.3e-03
psoriasis 1.200 2.1e-03
subependymal giant cell astrocytoma 2.272 8.1e-03

Gene RIF (4)

AA Sequence

MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKQLRQETFCCPQCRAPFHMDS      1 - 70
LRPNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQHKGHTTALVEDVCQGYKEKL     71 - 140
QKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIRSDFKNLQCFLHEEEKSYLWRLEKEEQQTLS    141 - 210
RLRDYEAGLGLKSNELKSHILELEEKCQGSAQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLY    211 - 280
FDVKKMLRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRRYFE    281 - 350
VDVGEGTGWDLGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEA    351 - 420
GVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD                             421 - 465
//

Text Mined References (21)

PMID Year Title