Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.95
PubTator Score 7.24

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O00635 B2R862
Symbols RNF15
RORET

Gene

Gene RIF (3)

PMID Text
23056470 TRIM38 may act as a novel negative regulator for TLR3-mediated type I interferon signaling by targeting TRIF for degradation
21789858 NF-kappaB is activated in response to TRIM38.
21306652 Enterovirus 71 infection induces degradation of TRIM38.

AA Sequence

MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKQLRQETFCCPQCRAPFHMDS      1 - 70
LRPNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQHKGHTTALVEDVCQGYKEKL     71 - 140
QKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIRSDFKNLQCFLHEEEKSYLWRLEKEEQQTLS    141 - 210
RLRDYEAGLGLKSNELKSHILELEEKCQGSAQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLY    211 - 280
FDVKKMLRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRRYFE    281 - 350
VDVGEGTGWDLGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEA    351 - 420
GVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD                             421 - 465
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
23056470 2012 TRIM38 negatively regulates TLR3-mediated IFN-? signaling by targeting TRIF for degradation.
21789858 2011 [Identification A novel protein TRIM38 that activate NF-kappaB signaling pathways].
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
21306652 2011 Enterovirus 71 induces degradation of TRIM38, a potential E3 ubiquitin ligase.
21269460 2011 Initial characterization of the human central proteome.
19084217 2009 Variants in TF and HFE explain approximately 40% of genetic variation in serum-transferrin levels.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
More...