Property Summary

NCBI Gene PubMed Count 10
Grant Count 5
R01 Count 5
Funding $234,134.25
PubMed Score 4.20
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
21980448 an autocrine function for netrin-1 and netrin-3 in U87 and U373 cells that slows migration

AA Sequence

MPGWPWGLLLTAGTLFAALSPGPPAPADPCHDEGGAPRGCVPGLVNAALGREVLASSTCGRPATRACDAS      1 - 70
DPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFVSLRFCSAPPASVALLKSQDH     71 - 140
GRSWAPLGFFSSHCDLDYGRLPAPANGPAGPGPEALCFPAPLAQPDGSGLLAFSMQDSSPPGLDLDSSPV    141 - 210
LQDWVTATDVRVVLTRPSTAGDPRDMEAVVPYSYAATDLQVGGRCKCNGHASRCLLDTQGHLICDCRHGT    211 - 280
EGPDCGRCKPFYCDRPWQRATARESHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHC    281 - 350
HYCREGFYRDPGRALSDRRACRACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAP    351 - 420
CVKTPIPGPTEDSSPVQPQDCDSHCKPARGSYRISLKKFCKKDYAVQVAVGARGEARGAWTRFPVAVLAV    421 - 490
FRSGEERARRGSSALWVPAGDAACGCPRLLPGRRYLLLGGGPGAAAGGAGGRGPGLIAARGSLVLPWRDA    491 - 560
WTRRLRRLQRRERRGRCSAA                                                      561 - 580
//

Text Mined References (10)

PMID Year Title
26190107 2015 A Floor-Plate Extracellular Protein-Protein Interaction Screen Identifies Draxin as a Secreted Netrin-1 Antagonist.
21980448 2011 Autocrine netrin function inhibits glioma cell motility and promotes focal adhesion formation.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
12471613 2003 Quantification of expression of netrins, slits and their receptors in human prostate tumors.
10634642 2000 Immunoglobulin V(H) gene mutational analysis suggests that blastic variant of mantle cell lymphoma derives from different stages of B-cell maturation.
10477713 1999 Unmutated Ig V(H) genes are associated with a more aggressive form of chronic lymphocytic leukemia.
10366627 1999 Netrin-3, a mouse homolog of human NTN2L, is highly expressed in sensory ganglia and shows differential binding to netrin receptors.
9887257 1999 Analysis of heavy and light chain pairings indicates that receptor editing shapes the human antibody repertoire.
9143507 1997 The NTN2L gene encoding a novel human netrin maps to the autosomal dominant polycystic kidney disease region on chromosome 16p13.3.
8828041 1996 Generation of a transcriptional map for a 700-kb region surrounding the polycystic kidney disease type 1 (PKD1) and tuberous sclerosis type 2 (TSC2) disease genes on human chromosome 16p3.3.