Property Summary

NCBI Gene PubMed Count 21
PubMed Score 136.86
PubTator Score 12.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 5.13631715061256E-7
medulloblastoma 1524 0.00175726976873179
lung cancer 4473 0.00813132078605623
primitive neuroectodermal tumor 3031 0.0088214819387702
subependymal giant cell astrocytoma 2287 0.0101886221038324
non diabetic and post-ischemic heart failure 200 0.0186717516405643
pilocytic astrocytoma 3086 0.0271539447916094
Disease Target Count Z-score Confidence
Heart disease 279 3.305 1.7
Primary cutaneous amyloidosis 26 3.02 1.5

Expression

Synonym

Accession O00631 Q6ICV3
Symbols

Gene

SLN

PDB

1JDM  

  Ortholog (2)

Species Source
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid

Gene RIF (13)

PMID Text
26743715 Phospholamban and sarcolipin are membrane proteins that differentially regulate SERCA function. (Review)
26522287 Molecular dynamics simulations help to clarify and to understand better the SLN pentamer channel that had a hydrophobic gate and could switch Na(+) and Cl(-) ion permeability by hydrated and vacuum states.
25983321 Although SLN and PLB binding to SERCA have different functional outcomes on the coupling efficiency of SERCA, both proteins decrease the apparent Ca(2+) affinity of the pump, suggesting that SLN and PLB inhibit SERCA by using a similar mechanism.
24358354 SLN and PLN are co-expressed in most fibers, which suggests that super-inhibition of SERCAs may be physiologically important in the regulation of intracellular Ca2+ in human skeletal muscle.
23362265 The C-terminal tail of SLN is a distinct, essential domain in the regulation of SERCA.
21640081 The selective downregulation of SLN and enhanced sarcoplasmic reticulum Ca(2+) uptake in human AF suggest that SLN downregulation could play an important role in abnormal intracellular Ca(2+) cycling in atrial pathology.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17515962 Gene expression of SLN was studied in children with congenital heart defects.
17010328 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGINTRELFLNFTIVLITVILMWLLVRSYQY                                             1 - 31
//

Text Mined References (23)

PMID Year Title
26743715 2016 Phospholamban and sarcolipin: Are they functionally redundant or distinct regulators of the Sarco(Endo)Plasmic Reticulum Calcium ATPase?
26522287 2016 Molecular dynamics of water and monovalent-ions transportation mechanisms of pentameric sarcolipin.
25983321 2015 Sarcolipin and phospholamban inhibit the calcium pump by populating a similar metal ion-free intermediate state.
25416956 2014 A proteome-scale map of the human interactome network.
24358354 2013 Co-expression of SERCA isoforms, phospholamban and sarcolipin in human skeletal muscle fibers.
23362265 2013 Sarco(endo)plasmic reticulum calcium ATPase (SERCA) inhibition by sarcolipin is encoded in its luminal tail.
21640081 2011 Decreased sarcolipin protein expression and enhanced sarco(endo)plasmic reticulum Ca2+ uptake in human atrial fibrillation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17515962 SERCA2a, phospholamban, sarcolipin, and ryanodine receptors gene expression in children with congenital heart defects.
More...