Property Summary

NCBI Gene PubMed Count 75
PubMed Score 15.45
PubTator Score 23.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
inflammatory breast cancer 1.100 1.1e-03
oligodendroglioma -1.300 3.3e-02
osteosarcoma -1.194 2.2e-05
ovarian cancer 1.300 7.8e-04
pancreatic cancer 1.100 4.4e-03
primary pancreatic ductal adenocarcinoma 1.484 6.6e-04
psoriasis -1.100 2.3e-04
spina bifida -1.269 2.7e-02

Gene RIF (61)

AA Sequence

MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQN      1 - 70
TSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALT     71 - 140
NIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP    141 - 210
SIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMV    211 - 280
IDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL    281 - 350
SNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLL    351 - 420
TVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDI    421 - 490
DEDPSLVPEAIQGGTFGFNSSANVPTEGFQF                                           491 - 521
//

Text Mined References (85)

PMID Year Title