Property Summary

NCBI Gene PubMed Count 65
Grant Count 1
Funding $74,935.88
PubMed Score 16.51
PubTator Score 23.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma -1.300 0.033
psoriasis -1.100 0.000
osteosarcoma -1.194 0.000
primary pancreatic ductal adenocarcinoma 1.484 0.001
inflammatory breast cancer 1.100 0.001
spina bifida -1.269 0.027
ovarian cancer 1.500 0.000
pancreatic cancer 1.100 0.004

Synonym

Accession O00629 A8K4S6 D3DNM2 O00190
Symbols QIP1
SRP3
IPOA3

Gene

PANTHER Protein Class (1)

 Grant Application (1)

PDB

4UAE  

Gene RIF (81)

PMID Text
26283154 Our results showed that miR-181 family expression was closely correlated with TCGA subtypes and patients' overall survival, indicating that miR-181b.
26245896 Karyopherin alpha 3 and karyopherin alpha 4 proteins mediate the nuclear import of methyl-CpG binding protein 2.
24284509 miR-223 downregulation promotes glomerular endothelial cell activation by upregulating importin alpha4 and alpha5 in IgA nephropathy
23861882 upon DNA damage transport adaptor importin-alpha4 imports XPA into the nucleus in an ATR-dependent manner.
23383277 Importin alpha3/Qip1 is involved in multiplication of mutant influenza virus with alanine mutation at amino acid 9 independently of nuclear transport function.
22928108 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
22928108 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
22509482 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
22174317 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
22110766 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
More...

AA Sequence

MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQN      1 - 70
TSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALT     71 - 140
NIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP    141 - 210
SIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMV    211 - 280
IDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL    281 - 350
SNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLL    351 - 420
TVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDI    421 - 490
DEDPSLVPEAIQGGTFGFNSSANVPTEGFQF                                           491 - 521
//

Text Mined References (75)

PMID Year Title
26283154 2015 Upregulation of miR-181s reverses mesenchymal transition by targeting KPNA4 in glioblastoma.
26245896 2015 Karyopherin ? 3 and karyopherin ? 4 proteins mediate the nuclear import of methyl-CpG binding protein 2.
25416956 2014 A proteome-scale map of the human interactome network.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24284509 2014 MiR-223 downregulation promotes glomerular endothelial cell activation by upregulating importin ?4 and ?5 in IgA nephropathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23864635 2013 Dissection of the C-terminal region of E1A redefines the roles of CtBP and other cellular targets in oncogenic transformation.
23861882 2013 UV-induced nuclear import of XPA is mediated by importin-?4 in an ATR-dependent manner.
23383277 2013 Importin ?3/Qip1 is involved in multiplication of mutant influenza virus with alanine mutation at amino acid 9 independently of nuclear transport function.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...