Property Summary

NCBI Gene PubMed Count 93
Grant Count 202
R01 Count 112
Funding $28,250,843.38
PubMed Score 247.29
PubTator Score 268.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis 1.800 0.001
tuberculosis -2.600 0.000
interstitial cystitis 1.500 0.002
psoriasis 2.100 0.000

Synonym

Accession O00626 A0N0Q6 B2R4W2
Symbols MDC
ABCD-1
SCYA22
STCP-1
DC/B-CK
A-152E5.1

Gene

Gene RIF (75)

PMID Text
26432403 type I IFN blocks the regulatory T cell-attracting chemokine CCL22 and thus helps limit the recruitment of regulatory T cells to tumors
26341115 increased amounts released by neutrophils from fibromyalgia patients
26093920 Distinctive Treg associated CCR4-CCL22 expression profile with altered frequency of Th17/Treg cell in the immunopathogenesis of Pemphigus Vulgaris.
25970596 First-episode psychosis patients had higher serum CCL22, which decreased substantially following antipsychotic treatment.
25922986 Our results demonstrate that CCL22 is expressed in human placenta. Decidual expression was only observed in miscarriage conditions and correlates with Treg infiltration.
25722218 The serum CCL22 levels were affected by genetic variations at SNP rs223818. Accordingly, SNP rs223818 may play a role in the susceptibility to breast cancer.
25647263 Elevated levels of CCL22 found in the ascites could create a chemokine gradient aiding in Treg cells migration. Increased Tregs percentage in the local microenvironment of ovarian cancer might be an important mechanism of immunosuppression.
25604093 Circulating CCL22 levels are related to both glioma risk and survival duration independent of age, histology, grade and IDH mutation status. CCL22 should be considered a marker of immune status with potential prognostic value
25352172 CCL22 could be an immune marker in ANCA-associated vasculitis.
25148803 CCR4 C1014T and CCL22 C16A genetic variations were neither associated with the risk, nor with the progression of colorectal cancer in Iranian population
More...

AA Sequence

MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTF      1 - 70
RDKEICADPRVPWVKMILNKLSQ                                                    71 - 93
//

Text Mined References (95)

PMID Year Title
26432403 2015 Suppression of intratumoral CCL22 by type i interferon inhibits migration of regulatory T cells and blocks cancer progression.
26341115 2016 Altered release of chemokines by phagocytes from fibromyalgia patients: a pilot study.
26093920 2015 Distinctive Treg associated CCR4-CCL22 expression profile with altered frequency of Th17/Treg cell in the immunopathogenesis of Pemphigus Vulgaris.
25970596 2015 Altered activation of innate immunity associates with white matter volume and diffusion in first-episode psychosis.
25922986 2015 Expression of CCL22 and Infiltration by Regulatory T Cells are Increased in the Decidua of Human Miscarriage Placentas.
25722218 2015 Higher circulating levels of chemokine CCL22 in patients with breast cancer: evaluation of the influences of tumor stage and chemokine gene polymorphism.
25647263 2015 Macrophage-derived chemokine CCL22 and regulatory T cells in ovarian cancer patients.
25604093 2015 Serum macrophage-derived chemokine/CCL22 levels are associated with glioma risk, CD4 T cell lymphopenia and survival time.
25352172 2015 Increase in Th17-associated CCL20 and decrease in Th2-associated CCL22 plasma chemokines in active ANCA-associated vasculitis.
25148803 2014 CCR4 C1014T and CCL22 C16A genetic variations in the Iranian patients with colorectal adenocarcinoma.
More...