Property Summary

NCBI Gene PubMed Count 98
PubMed Score 268.60
PubTator Score 268.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Dermatitis, Atopic 37 0.0 0.0
Disease Target Count P-value
psoriasis 6694 5.6e-30
tuberculosis 2010 3.2e-07
interstitial cystitis 2312 3.8e-04
Atopic dermatitis 952 7.0e-04

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis 1.800 7.0e-04
interstitial cystitis 1.400 3.8e-04
psoriasis 1.200 5.6e-30
tuberculosis -2.600 3.2e-07

Gene RIF (80)

AA Sequence

MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTF      1 - 70
RDKEICADPRVPWVKMILNKLSQ                                                    71 - 93
//

Text Mined References (100)

PMID Year Title