Property Summary

NCBI Gene PubMed Count 19
Grant Count 41
R01 Count 12
Funding $24,707,523.95
PubMed Score 455.87
PubTator Score 52.91

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25680527 Pirin regulates E-cadherin independently of Bcl3-Slug signaling.
24390086 The NRF2 transcription factor binds to this element in vivo and drives the basal PIR expression.
24272884 Pirin is a newly identified binding partner of EAF2/U19 capable of down-regulating EAF2/U19 protein and alleviating its inhibition of prostate cancer cell survival/proliferation.
23716661 Data indicate that the R-shaped area composes the interface for pirin-NF-kappaB binding that is responsible for modulation of NF-kappaB's DNA-binding properties.
21514450 pirin may have a relevant role in melanoma progression.
20711196 knockdown of pirin or treatment with the small molecule inhibited melanoma cell migration
20089166 An abnormal pattern of PIR sub-cellular localization is a characteristic feature of a subset of melanomas, and suggest it may represent a marker associated with disease progression.
20010624 Pirin downregulation is a feature of acute myeloid leukemia and leads to impairment of terminal myeloid differentiation.
19766747 This study aimed to examine genetic variations in the PIR gene by a comprehensive tagging method and its sex-specific effects on bone mineral density and osteoporotic risk.
19766747 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEG      1 - 70
GSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIP     71 - 140
KPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQ    141 - 210
KIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFER    211 - 280
AKTWKSKIGN                                                                281 - 290
//

Text Mined References (22)

PMID Year Title
25680527 2015 Pirin regulates epithelial to mesenchymal transition independently of Bcl3-Slug signaling.
24390086 2014 Basal PIR expression in HeLa cells is driven by NRF2 via evolutionary conserved antioxidant response element.
24272884 2014 Pirin down-regulates the EAF2/U19 protein and alleviates its growth inhibition in prostate cancer cells.
23716661 2013 Pirin is an iron-dependent redox regulator of NF-?B.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21514450 2011 Pirin inhibits cellular senescence in melanocytic cells.
21269460 2011 Initial characterization of the human central proteome.
20711196 2010 A small-molecule inhibitor shows that pirin regulates migration of melanoma cells.
20089166 2010 Pirin delocalization in melanoma progression identified by high content immuno-detection based approaches.
20010624 2010 Pirin downregulation is a feature of AML and leads to impairment of terminal myeloid differentiation.
More...