Property Summary

NCBI Gene PubMed Count 19
PubMed Score 455.87
PubTator Score 52.91

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O00625 Q5U0G0 Q6FHD2
Symbols

Gene

PIR

PDB

1J1L   3ACL   4ERO   4EWA   4EWD   4EWE   4GUL   4HLT  

  Ortholog (11)

Gene RIF (12)

PMID Text
25680527 Pirin regulates E-cadherin independently of Bcl3-Slug signaling.
24390086 The NRF2 transcription factor binds to this element in vivo and drives the basal PIR expression.
24272884 Pirin is a newly identified binding partner of EAF2/U19 capable of down-regulating EAF2/U19 protein and alleviating its inhibition of prostate cancer cell survival/proliferation.
23716661 Data indicate that the R-shaped area composes the interface for pirin-NF-kappaB binding that is responsible for modulation of NF-kappaB's DNA-binding properties.
21514450 pirin may have a relevant role in melanoma progression.
20711196 knockdown of pirin or treatment with the small molecule inhibited melanoma cell migration
20089166 An abnormal pattern of PIR sub-cellular localization is a characteristic feature of a subset of melanomas, and suggest it may represent a marker associated with disease progression.
20010624 Pirin downregulation is a feature of acute myeloid leukemia and leads to impairment of terminal myeloid differentiation.
19766747 This study aimed to examine genetic variations in the PIR gene by a comprehensive tagging method and its sex-specific effects on bone mineral density and osteoporotic risk.
19766747 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEG      1 - 70
GSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIP     71 - 140
KPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQ    141 - 210
KIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFER    211 - 280
AKTWKSKIGN                                                                281 - 290
//

Text Mined References (22)

PMID Year Title
25680527 2015 Pirin regulates epithelial to mesenchymal transition independently of Bcl3-Slug signaling.
24390086 2014 Basal PIR expression in HeLa cells is driven by NRF2 via evolutionary conserved antioxidant response element.
24272884 2014 Pirin down-regulates the EAF2/U19 protein and alleviates its growth inhibition in prostate cancer cells.
23716661 2013 Pirin is an iron-dependent redox regulator of NF-?B.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21514450 2011 Pirin inhibits cellular senescence in melanocytic cells.
21269460 2011 Initial characterization of the human central proteome.
20711196 2010 A small-molecule inhibitor shows that pirin regulates migration of melanoma cells.
20089166 2010 Pirin delocalization in melanoma progression identified by high content immuno-detection based approaches.
20010624 2010 Pirin downregulation is a feature of AML and leads to impairment of terminal myeloid differentiation.
More...