Property Summary

NCBI Gene PubMed Count 20
PubMed Score 503.83
PubTator Score 52.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia -1.200 3.4e-02
Barrett's esophagus -1.200 3.4e-02
Breast cancer 1.900 3.7e-07
colon cancer 1.900 9.4e-03
cystic fibrosis -1.991 1.9e-04
esophageal adenocarcinoma -1.300 2.1e-02
fibroadenoma -1.500 2.9e-02
group 3 medulloblastoma -1.600 1.2e-03
head and neck cancer and chronic obstruc... -1.300 9.0e-04
interstitial cystitis -2.300 5.1e-04
intraductal papillary-mucinous carcinoma... 1.100 2.9e-02
lung cancer 2.500 7.1e-05
malignant mesothelioma 1.600 2.9e-07
medulloblastoma, large-cell -2.200 1.9e-04
non-small cell lung cancer 1.171 2.6e-05
pancreatic ductal adenocarcinoma liver m... -1.103 4.6e-03

Gene RIF (13)

AA Sequence

MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEG      1 - 70
GSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIP     71 - 140
KPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQ    141 - 210
KIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFER    211 - 280
AKTWKSKIGN                                                                281 - 290
//

Text Mined References (23)

PMID Year Title