Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.23
PubTator Score 2.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Liver Cirrhosis 181 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 0.9
Ankylosing spondylitis 140 0.0 1.5
Disease Target Count Z-score Confidence
Glycogen storage disease 39 3.34 1.7
Hypophosphatemia 40 3.261 1.6

Gene RIF (2)

AA Sequence

MDGKPATRKGPDFCSLRYGLALIMHFSNFTMITQRVSLSIAIIAMVNTTQQQGLSNASTEGPVADAFNNS      1 - 70
SISIKEFDTKASVYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKKMLGAGLLISSLLTLFTPLAA     71 - 140
DFGVILVIMVRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFIILCVGGLISQALSWP    141 - 210
FIFYIFGSTGCVCCLLWFTVIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIFL    211 - 280
GFFSHFWLCTIILTYLPTYISTLLHVNIRDSGVLSSLPFIAAASCTILGGQLADFLLSRNLLRLITVRKL    281 - 350
FSSLGLLLPSICAVALPFVASSYVITIILLILIPGTSNLCDSGFIINTLDIAPRYASFLMGISRGFGLIA    351 - 420
GIISSTATGFLISQVGPVY                                                       421 - 439
//

Text Mined References (8)

PMID Year Title