Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.23
PubTator Score 2.47

Knowledge Summary

Patent

No data available

Synonym

Accession O00624 A6NK81 A6NLD6 Q5TB84 Q76P85
Symbols NPT3

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
26852655 Association was detected in premenopausal women of European descent between percent iron saturation and variants in the chromosome 6 region containing both HFE and SLC17A2 genes.
19890391 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDGKPATRKGPDFCSLRYGLALIMHFSNFTMITQRVSLSIAIIAMVNTTQQQGLSNASTEGPVADAFNNS      1 - 70
SISIKEFDTKASVYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKKMLGAGLLISSLLTLFTPLAA     71 - 140
DFGVILVIMVRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFIILCVGGLISQALSWP    141 - 210
FIFYIFGSTGCVCCLLWFTVIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIFL    211 - 280
GFFSHFWLCTIILTYLPTYISTLLHVNIRDSGVLSSLPFIAAASCTILGGQLADFLLSRNLLRLITVRKL    281 - 350
FSSLGLLLPSICAVALPFVASSYVITIILLILIPGTSNLCDSGFIINTLDIAPRYASFLMGISRGFGLIA    351 - 420
GIISSTATGFLISQVGPVY                                                       421 - 439
//

Text Mined References (8)

PMID Year Title
26852655 2016 Genome-wide association study of serum iron phenotypes in premenopausal women of European descent.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
19890391 2009 Common polymorphisms influencing serum uric acid levels contribute to susceptibility to gout, but not to coronary artery disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9149941 1997 A 1.1-Mb transcript map of the hereditary hemochromatosis locus.