Property Summary

NCBI Gene PubMed Count 50
Grant Count 15
R01 Count 4
Funding $3,682,540.02
PubMed Score 75.10
PubTator Score 73.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (35)

PMID Text
26792363 Ficolin-1 was decreased in patients compared with controls measured at 6 h (median 0.13 vs 0.33 mug/ml, respectively, p < 0.0001). At 48 h, ficolin-1 was significantly higher
26154564 Data indicate differences in the plasma concentrations of collectin liver 1 and collectin kidney 1, M-ficolin and H-ficol in systemic lupus erythematosus (SLE) patients compared to a group of healthy controls.
25069872 This study aims to investigate whether an association exists between the ficolins that are part of the lectin complement pathway and systemic lupus erythematosus.
24161415 the differential binding of ficolin-1 to lymphocyte subsets suggests ficolin-1 as a novel link between innate and adaptive immunity.
24022747 In patients with early rheumatoid arthritis, elevated plasma M-ficolin levels correlated with a high disease activity score at baseline and 1 year. A low M-ficolin level was the strongest predictor of remission and low disease activity.
23817411 These results demonstrate that ficolin-1 and PTX3 heterocomplex formation acts as a noninflammatory "find me and eat me" signal to sequester altered-host cells.
23383108 HIV-1 gp41 significantly inhibits FCN1 expression in human PBMCs
23209787 Study interlinks the genotype and phenotype relationship concerning polymorphisms in FCN1 and corresponding concentrations and biological functions of M-ficolin.
23184524 M-ficolin bound strongly to serotype 19B and 19C polysaccharides.
23182717 Data show that a photodynamic therapy (PDT) dose-dependent upregulation of CRP gene, as well as of PTX3 and ficolin 1 genes in lung tumor A549 cells, and indicate critical role played by PI3K/Akt/AP-1 pathway.
More...

AA Sequence

MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIG      1 - 70
ERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCR     71 - 140
PLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVD    141 - 210
FEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWY    211 - 280
ADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA                            281 - 326
//

Text Mined References (54)

PMID Year Title
26792363 2016 Early ficolin-1 is a sensitive prognostic marker for functional outcome in ischemic stroke.
26154564 2015 Collectin liver 1 and collectin kidney 1 and other complement-associated pattern recognition molecules in systemic lupus erythematosus.
25069872 2015 Ficolins and the lectin pathway of complement in patients with systemic lupus erythematosus.
24161415 2014 The pattern recognition molecule ficolin-1 exhibits differential binding to lymphocyte subsets, providing a novel link between innate and adaptive immunity.
24022747 2013 M-ficolin levels reflect disease activity and predict remission in early rheumatoid arthritis.
23817411 2013 Ficolin-1-PTX3 complex formation promotes clearance of altered self-cells and modulates IL-8 production.
23209787 2012 Non-synonymous polymorphisms in the FCN1 gene determine ligand-binding ability and serum levels of M-ficolin.
23184524 2013 M-ficolin binds selectively to the capsular polysaccharides of Streptococcus pneumoniae serotypes 19B and 19C and of a Streptococcus mitis strain.
23182717 2013 Upregulation of genes for C-reactive protein and related pentraxin/complement proteins in photodynamic therapy-treated human tumor cells: enrolment of PI3K/Akt and AP-1.
22941510 2013 Susceptibility to leprosy is associated with M-ficolin polymorphisms.
More...