Property Summary

NCBI Gene PubMed Count 53
PubMed Score 81.58
PubTator Score 73.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
chronic lymphosyte leukemia -3.300 1.9e-12
cutaneous lupus erythematosus 1.100 2.0e-02
interstitial cystitis 2.800 2.8e-03
intraductal papillary-mucinous adenoma (... -1.400 3.9e-03
intraductal papillary-mucinous carcinoma... -1.300 7.6e-03
intraductal papillary-mucinous neoplasm ... -1.500 2.3e-02
lung adenocarcinoma -1.500 3.6e-11
lung cancer -1.100 1.8e-03
lung carcinoma -1.200 1.6e-15
mucosa-associated lymphoid tissue lympho... 2.312 1.3e-02
nephrosclerosis 1.525 2.2e-02
non primary Sjogren syndrome sicca -1.600 2.1e-02
non-small cell lung cancer -2.668 7.0e-22
osteosarcoma -4.715 2.3e-07
ovarian cancer -3.000 2.3e-10
periodontitis 1.100 2.7e-26
psoriasis 1.300 3.5e-23
sarcoidosis 1.100 2.3e-02
tuberculosis 4.000 3.0e-07
ulcerative colitis 1.600 3.8e-03

Protein-protein Interaction (10)

Gene RIF (38)

AA Sequence

MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIG      1 - 70
ERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCR     71 - 140
PLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVD    141 - 210
FEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWY    211 - 280
ADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA                            281 - 326
//

Text Mined References (57)

PMID Year Title