Property Summary

NCBI Gene PubMed Count 78
PubMed Score 257.90
PubTator Score 171.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.726 1.4e-03
active ulcerative colitis 1.456 7.5e-03
Astrocytoma, Pilocytic 1.200 9.0e-06
Breast cancer -1.700 2.3e-08
breast carcinoma -1.100 1.7e-03
colon cancer 1.700 3.3e-08
cystic fibrosis 2.269 9.4e-07
dermatomyositis 1.200 5.4e-03
esophageal adenocarcinoma 1.100 2.3e-02
glioblastoma 1.500 1.6e-02
group 3 medulloblastoma 1.400 3.1e-03
intraductal papillary-mucinous adenoma (... -1.800 8.9e-06
intraductal papillary-mucinous carcinoma... -1.300 3.5e-03
lung adenocarcinoma -1.900 5.2e-15
malignant mesothelioma 5.300 5.2e-10
non-small cell lung cancer -1.359 3.2e-14
ovarian cancer -2.600 4.0e-07
pancreatic ductal adenocarcinoma liver m... 1.305 1.7e-02
psoriasis -1.200 8.0e-07

Protein-protein Interaction (4)

Gene RIF (56)

AA Sequence

MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSK      1 - 70
ANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTAT     71 - 140
AKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLM    141 - 210
KISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTS    211 - 280
SQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ    281 - 350
TQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLP    351 - 420
AKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAALYGCCHQRLSQR    421 - 490
KDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEKKVVSLNGELGDSWIVPLDNLTKDDLDEEEDTHL      491 - 558
//

Text Mined References (85)

PMID Year Title