Property Summary

NCBI Gene PubMed Count 72
Grant Count 88
R01 Count 63
Funding $6,922,688.68
PubMed Score 241.52
PubTator Score 171.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession O00592 A6NHX8 Q52LZ7 Q53ER6
Symbols PC
PCLP
Gp200
PCLP-1

Gene

Gene RIF (50)

PMID Text
26674770 In gastric cancer, PODXL expression by the polyclonal antibody HPA2110 is an independent marker of poor prognosis.
26329844 Data show that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than like L-selectin interactions at the single-molecule level.
26276714 PCLP1 expressed on breast tumor cells may function as an immunomodulatory molecule, which may represent a mechanism to evade the immune response.
26135398 EZR, CLIC5 and PODXL are overexpressed in hepatocellular carcinoma and may have a role in cell migration and invasiveness
26053486 podocalyxin to be an independent factor for poor prognosis in PDAC. To our knowledge, this is the first such report of its prognostic value.
26017117 PCX promotes cisplatin chemoresistance in osteosarcoma cells through a PI3Kdependent mechanism.
25915207 PODXL up-regulates the expression level of Bmi1 in OTSCC cells.
25905599 Obese subjects showed evidence of renal alteration through the detection of a higher number of urinary podocalyxin positive cells.
25887862 We show that podocalyxin plays a key role in the formation of primary tumors and distant tumor metastasis.
25738314 miR-125b was found to be important in arteriosclerosis obliterans by suppressing the expression of PODXL and may serve as a potential therapeutic target for the treatment of arteriosclerosis obliterans.
More...

AA Sequence

MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSK      1 - 70
ANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTAT     71 - 140
AKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLM    141 - 210
KISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTS    211 - 280
SQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ    281 - 350
TQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLP    351 - 420
AKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAALYGCCHQRLSQR    421 - 490
KDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEKKVVSLNGELGDSWIVPLDNLTKDDLDEEEDTHL      491 - 558
//

Text Mined References (79)

PMID Year Title
26674770 2015 Podocalyxin as a Prognostic Marker in Gastric Cancer.
26329844 2015 Distinct kinetic and mechanical properties govern mucin 16- and podocalyxin-mediated tumor cell adhesion to E- and L-selectin in shear flow.
26276714 2015 Podocalyxin-like protein 1 functions as an immunomodulatory molecule in breast cancer cells.
26135398 2015 Co-Expression of Ezrin-CLIC5-Podocalyxin Is Associated with Migration and Invasiveness in Hepatocellular Carcinoma.
26053486 2015 Podocalyxin Is a Marker of Poor Prognosis in Pancreatic Ductal Adenocarcinoma.
26017117 2015 Podocalyxin promotes cisplatin chemoresistance in osteosarcoma cells through phosphatidylinositide 3-kinase signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915207 2015 Bmi1 essentially mediates podocalyxin-enhanced Cisplatin chemoresistance in oral tongue squamous cell carcinoma.
25905599 2016 Urinary podocalyxin, the novel biomarker for detecting early renal change in obesity.
25887862 2015 Podocalyxin enhances breast tumor growth and metastasis and is a target for monoclonal antibody therapy.
More...