Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.45
PubTator Score 9.44

Knowledge Summary

Patent (3,100)

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -2.300 0.000
medulloblastoma, large-cell 1.100 0.000
pancreatic ductal adenocarcinoma liver m... 4.438 0.002
active Crohn's disease 2.219 0.009
active ulcerative colitis 2.855 0.003
pancreatic cancer 3.200 0.000
breast carcinoma -2.600 0.000
cystic fibrosis -1.400 0.001
lung adenocarcinoma 1.100 0.009
primary Sjogren syndrome 1.600 0.001
invasive ductal carcinoma -3.289 0.001
nasopharyngeal carcinoma -2.700 0.002
Breast cancer -6.000 0.000
gastric carcinoma 2.800 0.038
ovarian cancer 2.000 0.001
head and neck cancer -1.200 0.015

Gene RIF (11)

PMID Text
26634217 genetic polymorphism is associated with systemic lupus erythematosus in female patients
25012653 data reveal a GABRP-ERK1/2-cytokeratin axis that maintains the migratory phenotype of basal-like breast cancer
20583128 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20103740 HOXA10 expression leads to production of a less progestin-responsive GABA receptor subtype pi
19834535 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19078961 Observational study of gene-disease association. (HuGE Navigator)
16187283 Data suggest that GABRP is progressively down-regulated with tumour-progression, and that it may be useful as a prognostic marker in breast cancer.
16172613 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNYSLHLAFVCLSLFTERMCIQGSQFNVEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIA      1 - 70
SISSISESNMDYTATIYLRQRWMDQRLVFEGNKSFTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLI     71 - 140
RLFSNGTVLYALRITTTVACNMDLSKYPMDTQTCKLQLESWGYDGNDVEFTWLRGNDSVRGLEHLRLAQY    141 - 210
TIERYFTLVTRSQQETGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVT    211 - 280
TVLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAAKDRGTTKEVEEVS    281 - 350
ITNIINSSISSFKRKISFASIEISSDNVDYSDLTMKTSDKFKFVFREKMGRIVDYFTIQNPSNVDHYSKL    351 - 420
LFPLIFMLANVFYWAYYMYF                                                      421 - 440
//

Text Mined References (19)

PMID Year Title
26634217 2015 The Association of the GABRP Polymorphisms with Systemic Lupus Erythematosus.
25012653 2014 GABA(A) receptor pi (GABRP) stimulates basal-like breast cancer cell migration through activation of extracellular-regulated kinase 1/2 (ERK1/2).
23470693 2013 Genome-wide association studies of pit-and-fissure- and smooth-surface caries in permanent dentition.
20583128 2010 Variation at the GABAA receptor gene, Rho 1 (GABRR1) associated with susceptibility to bipolar schizoaffective disorder.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20103740 2010 HOXA10 regulates endometrial GABAA {pi} receptor expression and membrane translocation.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19078961 2010 Strong genetic evidence for a selective influence of GABAA receptors on a component of the bipolar disorder phenotype.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...