Property Summary

Ligand Count 10
NCBI Gene PubMed Count 18
PubMed Score 12.71
PubTator Score 9.44

Knowledge Summary

Patent (3,100)

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 2.219 9.0e-03
active ulcerative colitis 2.855 2.7e-03
Breast cancer -6.000 2.3e-14
breast carcinoma -2.000 6.1e-03
cystic fibrosis -1.400 1.2e-03
gastric carcinoma 2.800 3.8e-02
head and neck cancer -1.200 1.5e-02
invasive ductal carcinoma -3.289 1.3e-03
lung adenocarcinoma 1.100 9.3e-03
medulloblastoma, large-cell 1.100 9.5e-05
nasopharyngeal carcinoma -2.700 2.0e-03
ovarian cancer 2.000 1.0e-03
pancreatic cancer 3.200 2.4e-04
pancreatic ductal adenocarcinoma liver m... 4.438 2.2e-03
primary Sjogren syndrome 1.600 8.0e-04
psoriasis -1.900 1.4e-08

Gene RIF (11)

AA Sequence

MNYSLHLAFVCLSLFTERMCIQGSQFNVEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIA      1 - 70
SISSISESNMDYTATIYLRQRWMDQRLVFEGNKSFTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLI     71 - 140
RLFSNGTVLYALRITTTVACNMDLSKYPMDTQTCKLQLESWGYDGNDVEFTWLRGNDSVRGLEHLRLAQY    141 - 210
TIERYFTLVTRSQQETGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVT    211 - 280
TVLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAAKDRGTTKEVEEVS    281 - 350
ITNIINSSISSFKRKISFASIEISSDNVDYSDLTMKTSDKFKFVFREKMGRIVDYFTIQNPSNVDHYSKL    351 - 420
LFPLIFMLANVFYWAYYMYF                                                      421 - 440
//

Text Mined References (19)

PMID Year Title