Property Summary

NCBI Gene PubMed Count 50
Grant Count 20
R01 Count 10
Funding $4,079,286.9
PubMed Score 150.36
PubTator Score 51.39

Knowledge Summary

Patent (47,111)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.200 0.000
osteosarcoma 1.139 0.000
ovarian cancer 1.200 0.000

Gene RIF (31)

PMID Text
25297873 ACKR2 mediates chemokine scavenging by primary human trophoblasts.
24644289 Data show the structural motifs in the atypical chemokine receptor 2 (ACKR2) are responsible for ligand binding, and suggest ACKR2-derived N-terminal peptides as being of potential therapeutic significance.
24013383 Data show that low decoy receptor D6 expression correlated to more invasive tumors and that tumor location influences D6 expression, which is lower in the more distal parts of the colon.
23633677 engagement of the ACR D6 by its ligands activates a beta-arrestin1-dependent, G protein-independent signaling pathway that results in the phosphorylation of the actin-binding protein cofilin through the Rac1-PAK1-LIMK1 cascade.
23479571 D6, which is upregulated in both inflammatory and tumor contexts, is an essential regulator of inflammatory leukocyte interactions with lymphatic endothelial cells(LECs) and is required for immature/mature DC discrimination by LECs.
23462454 co-expression of DARC, D6, and CCX-CKR significantly associated with higher survival in gastric cancer
22939232 We here summarize the knowledge available today on D6 structural and signaling properties and its essential role for the control of inflammatory cells traffic and proper development of the adaptive immune response.
22867710 These data demonstrate a novel role for D6 as a regulator of the transition from uninvolved to lesional skin in psoriasis.
22797410 D6 is expressed in AMs from patients with COPD, and its expression correlates with the degree of functional impairment and markers of immune activation.
22796582 Chemokine decoy receptor D6 limits CC-chemokine-dependent pathogenic inflammation and is required for adequate cardiac remodeling after myocardial infarction.
More...

AA Sequence

MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLPVFYSLIFVLGLSGNLLLLMV      1 - 70
LLRYVPRRRMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMVSTLYTINFYSGIFFISCMSL     71 - 140
DKYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKGVWNCHADFGGHGTIWKLFL    141 - 210
RFQQNLLGFLLPLLAMIFFYSRIGCVLVRLRPAGQGRALKIAAALVVAFFVLWFPYNLTLFLHTLLDLQV    211 - 280
FGNCEVSQHLDYALQVTESIAFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSES    281 - 350
SILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA                                        351 - 384
//

Text Mined References (56)

PMID Year Title
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
25297873 2014 Atypical chemokine receptor ACKR2 mediates chemokine scavenging by primary human trophoblasts and can regulate fetal growth, placental structure, and neonatal mortality in mice.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24699281 2014 Genetic signatures for enhanced olfaction in the African mole-rats.
24644289 2014 The N-terminal region of the atypical chemokine receptor ACKR2 is a key determinant of ligand binding.
24013383 2013 Expression of the chemokine decoy receptor D6 is decreased in colon adenocarcinomas.
23633677 2013 ?-arrestin-dependent activation of the cofilin pathway is required for the scavenging activity of the atypical chemokine receptor D6.
23479571 2013 An analysis of the function and expression of D6 on lymphatic endothelial cells.
23462454 2013 Prognostic impact of atypical chemokine receptor expression in patients with gastric cancer.
23356288 2013 Atypical chemokine receptors: from silence to sound.
More...