Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.88
PubTator Score 5.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.48483966683139E-26
lung carcinoma 2844 5.45618877393514E-23
lung adenocarcinoma 2714 1.87392916777856E-13
pilocytic astrocytoma 3086 2.44213591281296E-6
sonic hedgehog group medulloblastoma 1482 1.37477573461965E-5
osteosarcoma 7933 1.91130965786243E-5
glioblastoma 5572 4.85568095877302E-5
adult high grade glioma 2148 3.82237702546555E-4
ulcerative colitis 2087 0.00150576710578783
interstitial cystitis 2299 0.00382640954965234
primary Sjogren syndrome 789 0.00485542649819028
Rheumatoid Arthritis 1171 0.0073049699555666
subependymal giant cell astrocytoma 2287 0.0141690418708783
medulloblastoma, large-cell 6234 0.0206315561820116
spina bifida 1064 0.0414949336106486
Disease Target Count Z-score Confidence
Alagille syndrome 15 3.292 1.6

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis -1.600 0.007
osteosarcoma -2.928 0.000
glioblastoma 1.500 0.000
sonic hedgehog group medulloblastoma 2.700 0.000
medulloblastoma, large-cell 1.900 0.021
non-small cell lung cancer -2.056 0.000
interstitial cystitis 1.600 0.004
adult high grade glioma 1.700 0.000
pilocytic astrocytoma 1.300 0.000
primary Sjogren syndrome 1.100 0.005
subependymal giant cell astrocytoma 1.047 0.014
lung adenocarcinoma -1.800 0.000
lung carcinoma -1.600 0.000
spina bifida 1.111 0.041
ulcerative colitis 1.200 0.002

Synonym

Accession O00587 B4DLT6 O43730 Q504S9
Symbols

Gene

  Ortholog (11)

Gene RIF (3)

PMID Text
25808869 Mfng is an oncogene acting through Notch-mediated induction of Pik3cg.
20237496 Observational study of gene-disease association. (HuGE Navigator)
15280477 down regulated in Papillomavirus-mediated cervical neoplasia.

AA Sequence

MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLR      1 - 70
LELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCH     71 - 140
VDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALK    141 - 210
MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFE    211 - 280
GKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR                                 281 - 321
//

Text Mined References (19)

PMID Year Title
25808869 2015 Manic fringe promotes a claudin-low breast cancer phenotype through notch-mediated PIK3CG induction.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15280477 2004 Papillomavirus-mediated neoplastic progression is associated with reciprocal changes in JAGGED1 and manic fringe expression linked to notch activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12486116 2003 Fringe modifies O-fucose on mouse Notch1 at epidermal growth factor-like repeats within the ligand-binding site and the Abruptex region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036964 2002 Notch ligands are substrates for protein O-fucosyltransferase-1 and Fringe.
More...