Property Summary

NCBI Gene PubMed Count 18
Grant Count 15
R01 Count 5
Funding $595,684.48
PubMed Score 5.88
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis -1.600 0.007
osteosarcoma -2.928 0.000
glioblastoma 1.500 0.000
sonic hedgehog group medulloblastoma 2.700 0.000
medulloblastoma, large-cell 1.900 0.021
non-small cell lung cancer -2.056 0.000
interstitial cystitis 1.600 0.004
adult high grade glioma 1.700 0.000
pilocytic astrocytoma 1.300 0.000
primary Sjogren syndrome 1.100 0.005
subependymal giant cell astrocytoma 1.047 0.014
lung adenocarcinoma -1.800 0.000
lung carcinoma -1.600 0.000
spina bifida 1.111 0.041
ulcerative colitis 1.200 0.002

Gene RIF (3)

PMID Text
25808869 Mfng is an oncogene acting through Notch-mediated induction of Pik3cg.
20237496 Observational study of gene-disease association. (HuGE Navigator)
15280477 down regulated in Papillomavirus-mediated cervical neoplasia.

AA Sequence

MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLR      1 - 70
LELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCH     71 - 140
VDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALK    141 - 210
MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFE    211 - 280
GKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR                                 281 - 321
//

Text Mined References (19)

PMID Year Title
25808869 2015 Manic fringe promotes a claudin-low breast cancer phenotype through notch-mediated PIK3CG induction.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15280477 2004 Papillomavirus-mediated neoplastic progression is associated with reciprocal changes in JAGGED1 and manic fringe expression linked to notch activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12486116 2003 Fringe modifies O-fucose on mouse Notch1 at epidermal growth factor-like repeats within the ligand-binding site and the Abruptex region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036964 2002 Notch ligands are substrates for protein O-fucosyltransferase-1 and Fringe.
More...