Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.67
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.700 3.8e-04
Astrocytoma, Pilocytic 1.300 5.0e-06
glioblastoma 1.300 2.6e-05
interstitial cystitis 1.100 1.0e-02
lung adenocarcinoma -1.400 2.8e-15
lung carcinoma -1.600 5.5e-23
medulloblastoma 1.500 1.1e-04
medulloblastoma, large-cell 1.600 6.0e-03
non-small cell lung cancer -1.002 4.2e-14
osteosarcoma -2.928 1.9e-05
primary Sjogren syndrome 1.100 4.9e-03
Rheumatoid arthritis -1.600 7.3e-03
spina bifida 1.111 4.1e-02
subependymal giant cell astrocytoma 1.047 1.4e-02
ulcerative colitis 1.200 1.5e-03

Gene RIF (3)

AA Sequence

MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLR      1 - 70
LELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCH     71 - 140
VDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALK    141 - 210
MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFE    211 - 280
GKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR                                 281 - 321
//

Text Mined References (19)

PMID Year Title