Property Summary

NCBI Gene PubMed Count 127
PubMed Score 697.26
PubTator Score 305.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.53452139803361E-13
breast carcinoma 1614 6.65780467267077E-13
lung cancer 4473 2.60208998374322E-5
lung adenocarcinoma 2714 4.11048528248364E-5
psoriasis 6685 7.45637174722656E-4
interstitial cystitis 2299 0.00371960768970251
aldosterone-producing adenoma 664 0.00939683268429327
interstitial lung disease 292 0.0321829898083913
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 3.314 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
interstitial lung disease 1.300 0.032
psoriasis -2.600 0.001
lung cancer -1.900 0.000
interstitial cystitis 2.200 0.004
lung adenocarcinoma -1.100 0.000
aldosterone-producing adenoma -1.529 0.009
lung carcinoma -2.500 0.000
breast carcinoma -1.500 0.000

Synonym

Accession O00585
Symbols ECL
SLC
CKb9
TCA4
6Ckine
SCYA21

Gene

PDB

2L4N  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

Gene RIF (96)

PMID Text
26884842 CCL21/CCR7 induce VEGF-D up-regulation and promote lymphangiogenesis via ERK/Akt pathway in lung cancer.
26667143 Our findings suggested that MUC1 plays an important role in CCL21-CCR7-induced lymphatic metastasis and may serve as a therapeutic target in esophageal squamous cell carcinoma .
26320593 CCL21 gene SNP (rs951005) might confer genetic predisposition to polymyositis patients or such patients with interstitial lung disease in a Chinese Han population.
26146068 over-expression of CCL21 could increased the expressions of antigen presentation-related genes in CK8/18 TECs in MG patients
25961925 TGF-beta1 promoted CCL21 expression in lymphatic endothelial cells. CCL21 acted in a paracrine fashion to mediate chemotactic migration of EMT cells toward lymphatic endothelial cells.
25957582 increased expression in mononuclear inflammatory cells isolated from the brain during active stage of experimental autoimmune encephalomyelitis
25744065 These results reveal that CCR7 and VEGF-C display a significant crosstalk and suggest a novel role of the CCL21/CCR7 chemokine axis in the promotion of breast cancer-induced lymphangiogenesis.
25688986 HIV-1 gp120 enhances CCL-21-induced CD4+ T cell chemotaxis in a CXCR4- and CD4-dependent manner
25575049 CCL21 promotes the metastasis of pancreatic cancer via epithelial-mesenchymal transition.
25556164 CCL21/CCR7 pathway activates signallings to up-regulate Slug pathway, leading to the occurrence of epithelial-mesenchymal transition process in human chondrosarcoma
More...

AA Sequence

MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRS      1 - 70
QAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP           71 - 134
//

Text Mined References (127)

PMID Year Title
26884842 2015 CCL21/CCR7 up-regulate vascular endothelial growth factor-D expression via ERK pathway in human non-small cell lung cancer cells.
26667143 2015 CCL21-CCR7 promotes the lymph node metastasis of esophageal squamous cell carcinoma by up-regulating MUC1.
26320593 A single-nucleotide polymorphism of CCL21 rs951005 T>C is associated with susceptibility of polymyositis and such patients with interstitial lung disease in a Chinese Han population.
26146068 2015 [Over-expression of CCL21 up-regulates the antigen presentation-related genes of CK8/18 positive thymic epithelial cells in patients with myasthenia gravis].
25961925 2016 TGF-?1-induced EMT promotes targeted migration of breast cancer cells through the lymphatic system by the activation of CCR7/CCL21-mediated chemotaxis.
25957582 2015 Central Nervous System and Peripheral Expression of CCL19, CCL21 and Their Receptor CCR7 in Experimental Model of Multiple Sclerosis.
25744065 2015 The role of CCL21/CCR7 chemokine axis in breast cancer-induced lymphangiogenesis.
25575049 2015 [CCL21 promotes the metastasis of human pancreatic cancer Panc-1 cells via epithelial- mesenchymal transition].
25556164 2015 Slug signaling is up-regulated by CCL21/CCR7 [corrected] to induce EMT in human chondrosarcoma.
25473269 2014 CCL19 and CCL21 modulate the inflammatory milieu in atherosclerotic lesions.
More...