Property Summary

NCBI Gene PubMed Count 140
PubMed Score 733.50
PubTator Score 305.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 174 0.0 0.0
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 3.407 1.7
Disease Target Count Z-score Confidence
Cancer 2499 4.345 2.2
Hypersensitivity reaction type II disease 253 3.061 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
aldosterone-producing adenoma -1.529 9.4e-03
breast carcinoma -1.500 6.7e-13
interstitial cystitis 2.200 3.7e-03
interstitial lung disease 1.300 3.2e-02
lung adenocarcinoma -1.100 4.1e-05
lung cancer -1.900 2.6e-05
lung carcinoma -2.500 2.5e-13
psoriasis -2.600 7.5e-04

Synonym

Accession O00585
Symbols ECL
SLC
CKb9
TCA4
6Ckine
SCYA21

Gene

PDB

2L4N   5EKI  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (6)

Gene RIF (108)

AA Sequence

MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRS      1 - 70
QAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP           71 - 134
//

Text Mined References (140)

PMID Year Title