Property Summary

NCBI Gene PubMed Count 42
Grant Count 3
Funding $384,904.5
PubMed Score 34.35
PubTator Score 78.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.629 0.001
osteosarcoma -2.071 0.000
astrocytoma 1.700 0.021
glioblastoma 2.000 0.001
medulloblastoma, large-cell -1.200 0.004
intraductal papillary-mucinous neoplasm ... 1.100 0.027
pilocytic astrocytoma 1.300 0.000
subependymal giant cell astrocytoma 1.687 0.007
ovarian cancer 2.400 0.000

Synonym

Accession O00584 B2RDA7 E1P5C3 Q5T8Q0 Q8TCU2 Q9BZ46 Q9BZ47
Symbols RNASE6PL
bA514O12.3

Gene

PDB

3T0O  

 GO Process (1)

Gene RIF (25)

PMID Text
26293343 inhibits melanocyte outgrowth through interacting with shootin1; this effect may be associated with vitiligo pathogenesis
26067323 RNASET2 may contribute to the development of vitiligo by inhibiting TNF Receptor-Associated Factor 2 expression and lead directly to apoptosis of melanocytes
25928629 RNASET2 tag SNP but not CCR6 polymorphisms is associated with autoimmune thyroid diseases in the Chinese Han population
25797262 Biological features allow to put forward the hypothesis that the RNASET2 protein can act as a molecular barrier for limiting the damages and tissue remodeling events occurring during the earlier step of cell transformation.
25663099 describe a multi-step strategy that allows production of highly pure, catalytically competent recombinant RNASET2 in both wild-type and mutant forms
25426551 RNASET2 has antitumorigenic and antiangiogenic activities; a truncated version of human RNASET2, starting at E50 (trT2-50) and devoid of ribonuclease activity, has actin binding and anticancer-related biological activities
24842157 Results show that downregulation of RNASET2 and GGNBP2 in drug-resistant ovarian cancer tissues/cells contributes to the regulation of drug resistance in ovarian cancer.
24457966 RNASET2 contributes to vitiligo pathogenesis by inhibiting TRAF2 expression.
24327149 Genotypes of single nucleotide polymorphisms (SNPs) in RNASET2 gene were determined.
23630276 Ribonuclease T2, an ancient and phylogenetically conserved RNase, has a role in development of ovarian neoplasms
More...

AA Sequence

MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPD      1 - 70
KSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLE     71 - 140
LYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQL    141 - 210
QNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH                            211 - 256
//

Text Mined References (43)

PMID Year Title
26293343 2015 Rnaset2 inhibits melanocyte outgrowth possibly through interacting with shootin1.
26067323 2015 Role and Mechanism of RNASET2 in the Pathogenesis of Vitiligo.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25928629 2015 RNASET2 tag SNP but not CCR6 polymorphisms is associated with autoimmune thyroid diseases in the Chinese Han population.
25797262 2015 Pleiotropic modes of action in tumor cells of RNASET2, an evolutionary highly conserved extracellular RNase.
25663099 2015 New Strategies for Expression and Purification of Recombinant Human RNASET2 Protein in Pichia pastoris.
25426551 2014 Human recombinant truncated RNASET2, devoid of RNase activity; A potential cancer therapeutic agent.
24842157 2014 Downregulation of tumor suppressor gene ribonuclease T2 and gametogenetin binding protein 2 is associated with drug resistance in ovarian cancer.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24457966 2014 Stress-induced RNASET2 overexpression mediates melanocyte apoptosis via the TRAF2 pathway in vitro.
More...