Property Summary

NCBI Gene PubMed Count 44
PubMed Score 37.38
PubTator Score 78.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.700 2.1e-02
Astrocytoma, Pilocytic 1.400 7.1e-07
glioblastoma 2.000 6.6e-04
intraductal papillary-mucinous neoplasm ... 1.100 2.7e-02
medulloblastoma, large-cell -1.200 3.8e-03
Multiple myeloma 1.629 1.4e-03
osteosarcoma -2.071 1.1e-04
ovarian cancer 2.400 3.8e-07
subependymal giant cell astrocytoma 1.687 7.2e-03

Protein-protein Interaction (2)

Gene RIF (27)

AA Sequence

MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPD      1 - 70
KSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLE     71 - 140
LYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQL    141 - 210
QNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH                            211 - 256
//

Text Mined References (45)

PMID Year Title