Property Summary

NCBI Gene PubMed Count 56
Grant Count 60
R01 Count 37
Funding $3,852,981.34
PubMed Score 118.81
PubTator Score 367.64

Knowledge Summary

Patent (19,155)

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 2.700 0.000
psoriasis 2.800 0.000
osteosarcoma -1.709 0.000
tuberculosis -2.900 0.000
interstitial cystitis 1.900 0.007
primary Sjogren syndrome 1.200 0.002

Synonym

Accession O00574 O00575 Q9HCA5 CXC-R6
Symbols BONZO
CD186
STRL33
TYMSTR

Gene

  TechDev Info (1)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
602244 screening 1305 / 0 / 361083 uHTS identification of CXCR6 Inhibitors in a B-arrestin luminescence assay
602249 summary 0 / 0 / 0 Summary assay for small molecule Inhibitors of CXCR6
602409 screening 458 / 0 / 246 Single concentration confirmation of uHTS hits from a small molecule antagonists of the CXCR6 receptor via a luminescent beta-arrestin assay
624129 confirmatory 15 / 0 / 595 Dose Response confirmation of uHTS hits from a small molecule antagonists of the CXCR6 receptor in a screening assay
651598 confirmatory 1 / 0 / 5 SAR analysis of small molecule antagonists of the CXCR6 receptor in an APJ-DiscoveRx counter screen panel assay
651708 confirmatory 7 / 0 / 28 SAR analysis of small molecule antagonists of the CXCR6 receptor in a screening panel assay - 3

Gene RIF (62)

PMID Text
26872014 MiR-361-5p was down-regulated in Hepatocellular Carcinoma tissues in comparison to adjacent normal tissues, due to hypermethylation at its promoter region. Overexpression of miR-361-5p suppressed proliferation and invasion of HCC cells. Chemokine (C-X-C Motif) receptor 6 (CXCR6) was identified as a target of miR-361-5p.
26708384 Wnt5a-Ror2 signaling enhances expression and secretion of CXCL16 in mesenchymal stem cells thereby activating CXCR6 expressed on tumor cells to promote proliferation.
26272362 high protein expression of CXCL16 and high protein co-expression of CXCL16/CXCR6 in prostate cancer were independent predictors for a worse clinical outcome
26021984 we examined the expression of CXCL16 and CXCR6 and their relations to prognosis in 335 unselected patients with NSCLC, and investigated possible relationships with our previously studied immunologic and angiogenic markers
25888629 Authors present evidence that chemokine receptor CXCR6 and its only natural ligand, CXCL16, are significantly expressed by non-small cell lung cancer (NSCLC) and are involved in the pathobiology of lung cancer.
25572735 high expression of CXCR6 is positively associated with distant invasion of human hepatocellular carcinoma (HCC) patients.
24507753 Our results suggest that the CXCL16/CXCR6 axis appears to be important in the progression of Ewing sarcoma family tumor
24302814 CXCL16/CXCR6 interaction may play an important role in modifying the response of pDCs to environmental danger signals
23628207 CXCL16 is highly expressed by glial tumor and stroma cells whereas CXCR6 defines a subset of cells with stem cell character.
23398954 Data suggest that expression of CXCR6 in T-cells and natural killer cells is up-regulated in subjects with metabolic syndrome and correlates with severity of carotid atherosclerosis (i.e., intima-media thickness and plaque index).
More...

AA Sequence

MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFL      1 - 70
VNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQ     71 - 140
QAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVC    141 - 210
YSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLR    211 - 280
ACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL            281 - 342
//

Text Mined References (56)

PMID Year Title
26872014 2016 MicroRNA-361-5p Inhibits Cancer Cell Growth by Targeting CXCR6 in Hepatocellular Carcinoma.
26708384 2016 Wnt5a-Ror2 signaling in mesenchymal stem cells promotes proliferation of gastric cancer cells by activating CXCL16-CXCR6 axis.
26272362 2015 The prognostic significance of CXCL16 and its receptor C-X-C chemokine receptor 6 in prostate cancer.
26021984 2015 Prognostic impact of CXCL16 and CXCR6 in non-small cell lung cancer: combined high CXCL16 expression in tumor stroma and cancer cells yields improved survival.
25888629 2015 CXCR6 expression in non-small cell lung carcinoma supports metastatic process via modulating metalloproteinases.
25572735 Blockade of the CXCR6 signaling inhibits growth and invasion of hepatocellular carcinoma cells through inhibition of the VEGF expression.
24507753 2014 CXCL16 and CXCR6 in Ewing sarcoma family tumor.
24302814 2013 Plasmacytoid dendritic cell response to CpG ODN correlates with CXCL16 expression and is inhibited by ox-LDL.
23628207 2013 The CXCL16-CXCR6 chemokine axis in glial tumors.
23398954 2013 Associations of CXCL16/CXCR6 with carotid atherosclerosis in patients with metabolic syndrome.
More...